[phenixbb] separate amino acid chains
Thomas C. Terwilliger
terwilliger at lanl.gov
Thu Sep 23 06:49:50 PDT 2010
Hi Florian,
Yes, chains are intended to be separated by a line starting with ">" in
automr, autobuild, autosol, etc. Usually that works fine. Can you
possibly send me (off-list is fine: terwilliger at lanl.gov) your sequence
file and I'll have a look (and try it out)?
Sequence files normally look like this:
> chain A of my protein
MSQDKWLEWAVRLQALAQTGLAYGKDVYDMERFEEIRQIAAEMLVEPSGQPLEVVKDLF
PPLYLGKNTAEQL
> chain B of my protein
LLVQENDGLWSLPGGWCDVDQSVKDNVVKEVKEEAGLDVEAQRVVAILDKHKNNPAK
All the best,
Tom T
>> Dear All,
>>
>> Quick question regarding the handling of different amino acid chains
>> in the Phenix Autobuild GUI.
>>
>> From the manual I understand that different amino acid chains are
>> separated by > ? I pasted the my amino acid chains in the GUI
>> separated with > ; I don't think in my case Phenix recognizes the
>> different chains as such, but as one contiguous protein.
>>
>> Am I missing anything obvious?
>>
>> Regards,
>>
>> Florian
>>
>> -----------------------------------------------------------
>> Florian Schmitzberger
>> Biological Chemistry and Molecular Pharmacology
>> Harvard Medical School
>> 250 Longwood Avenue, SGM 130
>> Boston, MA 02115, US
>> Tel: 001 617 432 5602
>>
>>
>>
>>
>>
>>
>>
>>
>>
>>
>> _______________________________________________
>> phenixbb mailing list
>> phenixbb at phenix-online.org
>> http://phenix-online.org/mailman/listinfo/phenixbb
>>
More information about the phenixbb
mailing list