Dear CCTBX developers,
I am a postdoc at EPFL working with HHpred for homology modeling of membrane proteins.
I have been trying to write my own HHpred alignment parser until I found the python script under “cctbx_fork/iotbx/bioinformatics/__init__.py/” that contains an HHpred parser.
My goal is to correctly parse the raw HHpred output file (.hhr), which involves unwrapping every alignment, parsing out a lot of text to finally obtain something like this:
>pdb_name
query-sequence
column score
Example:
>4U15
VYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWS
+........+..+..++|+++|++++.++.+.++++ +..+.++.+|+++|++.++...+........ +...|..
Being somewhat new to python, I was wondering whether the people who wrote this script are still around and could help me figure out whether the parser could be implemented in such a way.
Thanks for any help you can provide!
Best,
Louis D
