- phenixbb - phenix-online.org

MSE MET occupancy issue
by Ming 27 Feb '12

27 Feb '12

Hi all, I was trying to refine a protein with phenix.refine. I want to refine AMSE and BMET with occupancies 0.5 and 0.5. What I did is modifying the pdb file by copy the coordinates of MET to MSE, and change the names to be AMSE and BMET, modifying the occupancy to be 0.5 and 0.5 for each one. Everything else like the atom names have been taken care of too. I used the readyset to make sure the pdb file is good. But phenix.refine keeps giving me error saying "numbers of atoms with unknown nonbonded energy type symbols ". Anyone here can help me with this please? Thanks in advance,

2 3

Phenix Error while running refinement
by Subhani Bandara 27 Feb '12

27 Feb '12

Hi everyone, I am getting following error while running phenix refinement for a protein cocrystalized with a metal chelator complex. What could be the problem. AssertionError : Traceback: File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/cctbx_project/libtbx/thread_utils.py", line 229, in run return_value = self._target(self._args, self._kwargs, self._c) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/cctbx_project/libtbx/runtime_utils.py", line 72, in __call__ result = self.target() File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/phenix/phenix/refinement/runtime.py", line 67, in __call__ call_back_handler=callback) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/phenix/phenix/refinement/command_line.py", line 97, in run call_back_handler=call_back_handler) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/phenix/phenix/refinement/driver.py", line 1478, in run ncs_manager = self.ncs_manager) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/phenix/phenix/refinement/strategies.py", line 344, in refinement_machine model.show_occupancy_statistics(text = "Occupancies statistics", out=log) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/cctbx_project/mmtbx/model.py", line 868, in show_occupancy_statistics self.xray_structure.set_occupancies(value=0., selection = less_than_zero) File "/Applications/PHENIX-1.7.3-928/Contents/phenix-1.7.3-928/cctbx_project/cctbx/xray/structure.py", line 480, in set_occupancies assert selection.size() == s.size() Thanks Subhani

3 4

mr problem and changed unit cell parameters
by intekhab alam 27 Feb '12

27 Feb '12

Hi all I have collected 2 datasets; one for the native proteins (2.3Å resolution) while other is for a protein-protein complex (3.5Å resolution). The unit cell parameters for the native are a=120, b=196, c=109, a=g=90, b=114, while for the complex data it is a=122, b=197, c=300, a=g=90, b=93. I have successfully got a MR solution and refined the native dataset with 3 monomers in the asymmetric unit. Analysis of the protein complex dataset shows 41% pseudo translation and so far there is no success in molecular replacement for this dataset. Can anyone please suggest me ways to solve this problem. i already have tried different templates like monomer, dimer, trimer, tetramer etc with truncations of loop region. i am using phaser, autoMR, molrep. Regards -- INTEKHAB ALAM LABORATORY OF STRUCTURAL BIOINFORMATICS KOREA UNIVERSITY, SEOUL

2 2

Using a parameter file in GUI
by Subhani Bandara 24 Feb '12

24 Feb '12

Hi everyone, I need to input a parameter file describing the bond lengths of a metal chelator complex in my protein. I used a text file containing the commands with .params extension. when I add this file in GUI inputs in refinement, it gives a message "Phenix did not recognize the file type". What is the file type I should use? The file contained commands similar to the following with my metal and ligand atom names. refinement.geometry_restraints.edits { zn_selection = chain X and resname ZN and resid 200 and name ZN his117_selection = chain X and resname HIS and resid 117 and name NE2 asp130_selection = chain X and resname ASP and resid 130 and name OD1 bond { action = *add atom_selection_1 = $zn_selection atom_selection_2 = $his117_selection symmetry_operation = None distance_ideal = 2.1 sigma = 0.02 slack = None } bond { action = *add atom_selection_1 = $zn_selection atom_selection_2 = $asp130_selection symmetry_operation = None distance_ideal = 2.1 sigma = 0.02 slack = None } } Then I used command line to run "phenix.refine model.pdb data.mtz elbow.cif restraints_edits.params" it again gave error saying .params is an unknown file type. Am I doing anything wrong and is there any other way to fix the distances of the metal chelator complex. Thanks Subhani

7 35

importing projects problem
by Haytham Wahba 23 Feb '12

23 Feb '12

i moved my project from computer to another i did import project under Files. i got my projects with all jop history but when i try to restor jop i get this report (see below) after that i see only .eff file under the input file, No .Sca or the pdb i used before. even the result of refinment is not there and refinment setting which i did not use. i tried to change the path in .eff file to the new location for .sca and .pdb but i did not help could you help me in that. thank you Haytham (((ImportError : No module named f_model_info Traceback (most recent call last): File "/usr/local/phenix-1.7-650/phenix/wxGUI2/Home/Jobs.py", line 327, in OnDoubleClick self.list_frame.restore_job(job) File "/usr/local/phenix-1.7-650/phenix/wxGUI2/Home/Jobs.py", line 241, in restore_job app.restore_job(self.project.get_id(), current_job) File "/usr/local/phenix-1.7-650/phenix/wxGUI2/App.py", line 544, in restore_job use_template_gui=use_template_gui) File "/usr/local/phenix-1.7-650/phenix/wxGUI2/App.py", line 501, in restore_session frame.restore_session(output_dir, config_file, result) File "/usr/local/phenix-1.7-650/phenix/wxGUI2/Programs/Refine/Main.py", line 473, in restore_session (result, last_status_file) = self._load_result_files(output_dir) File "/usr/local/phenix-1.7-650/phenix/wxGUI2/Programs/Refine/Main.py", line 467, in _load_result_files refine_result = easy_pickle.load(result_file) File "/usr/local/phenix-1.7-650/cctbx_project/libtbx/easy_pickle.py", line 21, in load return cPickle.loads(_open(file_name, "rb").read()) ImportError: No module named f_model_info)))

2 1

question about phenix rosetta with two chains
by Elena Seiradake 23 Feb '12

23 Feb '12

Dear Phenixians, I would like to use mr_rosetta to re-build a model with two copies per AU. Although the two copies have the same sequence, they adopt different conformations and one is partially disordered. So I don't want to impose NCS. Could someone please send me an example input file for running mr_rosetta with phenix for multiple chains of the same protein? I think this probably would have to contain "fragment_files_chain_list" and "fragment_files_3_mer_by_chain" etc. (?) I have tried including the above keys in my script, in various ways, but I always get the error: "Sorry, the file path/test_1.pdb representing group 1 has no atoms? This could indicate a problem with sequence alignment in rebuilding" When I run it with just one of the two chains in my pdb (using simple "fragment_file ="), it rebuilds happily. Also, when use both chains and impose NCS=2 it works, but then one of the two chains is forced into the wrong conformation. Any advice on how to change my script would be welcome! Below is part of my simple script, the one that runs ok, using "fragment_file =". seq_file= Seq.dat \ data=test.mtz \ search_models=test.pdb \ already_placed=True \ fragment_files= frag_A_3.gz \ fragment_files= frag_A_9.gz \ rescore_mr.relax=False \ rosetta_models=20 \ ncs_copies= 1\ Cheers Elena

2 1

composite omit map
by Ursula Schulze-Gahmen 22 Feb '12

22 Feb '12

I tried to calculate a composite omit map in autobuild for 3 complexes in the au. The calculation finished without any problems, but the maps look not right. There is density for the molecule, but there is a lot of density in the solvent areas, which I never saw when I calculated regular 2fo-fc maps or fo-fc maps. I also have calculated omit maps in autobuild before for single problem region and never saw anything like this. Any idea what could have gone wrong? Where should I start looking? Ursula -- Ursula Schulze-Gahmen, Ph.D. Assistant Researcher UC Berkeley, QB3 356 Stanley Hall #3220 Berkeley, CA 94720-3220

2 1

autoMR fixed ensemble error
by Alexander Batyuk 22 Feb '12

22 Feb '12

Dear all, I have the following error while trying to put fixed ensemble into AutoMR: Adding Ensemble c1 as fixed solution with: Euler angles: [359.98, 0.0, 0.0] Coords (orthogonal A): [-1.0, 0.476, -1.001] *************ERROR ENDING ******************* **************************************** AutoMR Input failed Python argument types in SOLU.addSOLU_6DIM_ENSE(InputMR_AUTO, str, list, bool, list, float, bool, bool, bool) did not match C++ signature: addSOLU_6DIM_ENSE(phaser::SOLU {lvalue}, std::string, scitbx::vec3<double>, bool, scitbx::vec3<double>, double, bool, bool, bool, bool, scitbx::vec3<double>, double) **************************************** *************ERROR ENDING ******************* What could be the reason for that? I'm running dev-986 on OS X 10.6.8. Stable 1.7.3 gives the same error. Best wishes, Alex -- Alex Batyuk The Plueckthun Lab www.bioc.uzh.ch/plueckthun

4 5

Re: [phenixbb] CCN Jan 2012 article : find_alt_origin_sym_mate
by R.D. Oeffner 21 Feb '12

21 Feb '12

Dear Bryan, The factor 0.9 is a purely empirical term. It serves two functions. One is to soften the minimas when atoms coalesce and to also prevent taking the logarithm of a negative number. The closer it gets to zero the more accurately it pinpoints the global minimum when the MLAD score is used for identifying the best superposition betweent two molecules. But if it becomes two small chances are that the landscape of MLAD values will be dotted with many very deep local minima which might lead to wrong results. The square boxes under the min, max symbols are typos to be ignored, sorry. There are currently no plans to publish further details about find_alt_origin_sym_mate. Regards, Robert Oeffner On Wed, Feb 15, 2012 at 4:33 PM, Bryan Lepore <bryanlepore at gmail.com> wrote: > will the find_alt_origin_sym_mate article in CCN Jan. 2012 be > described in any other publications? ... e.g. Acta Cryst., because I am interested in particular : 1. what is the significance of the factor of 0.9 2. is the MLAD a novel formula also, the 'min' and 'max' on p. 6 have small boxes under them [*] as if missing a character - are these integrals? -Bryan [*] tried evince and Adobe Reader on Linux, Adobe Acrobat on OSX 10.5.8 -- Robert Oeffner, Ph.D. Research Associate Department of Haematology, University of Cambridge Cambridge Institute of Medical Research Wellcome Trust / MRC Building, Hills Road, Cambridge, CB2 0XY www-structmed.cimr.cam.ac.uk, tel:01223763234, mobile:07712 887162

5 5

error in running autobuild
by intekhab alam 20 Feb '12

20 Feb '12

hi i am working with phenix version 1.7.1-743. after running auto mr i tried to run autobuild but it failed and generated the following message. i am unable to run autobuild now. kindly help. OError : [Errno 5] Input/output error Traceback (most recent call last): File "/usr/local/phenix-1.7.1-743/phenix/wxGUI2/Runtime.py", line 172, in OnUpdate self.propagate_event(event, "OnUpdate") File "/usr/local/phenix-1.7.1-743/phenix/wxGUI2/Runtime.py", line 228, in propagate_event fn(event) File "/usr/local/phenix-1.7.1-743/phenix/wxGUI2/Programs/Phaser/Output.py", line 194, in OnUpdate self.process_callback(callback.message, callback.data) File "/usr/local/phenix-1.7.1-743/phenix/wxGUI2/Programs/Phaser/Output.py", line 209, in process_callback print "CALLBACK: %s %s" % (str(message), str(data)) IOError: [Errno 5] Input/output erro -- INTEKHAB ALAM LABORATORY OF STRUCTURAL BIOINFORMATICS KOREA UNIVERSITY, SEOUL

3 2

FFT map coefficients only for certain chains
by Zhang yu 19 Feb '12

19 Feb '12

Dear Phenixers, Is that possible to generate map coefficients only for certain chains? For example, I have two chains, A and B, and I would like to output a map file only contains coefficients for chain A. The "isomesh" command in Pymol could generate similar images. But my purpose is not for presentation, I need a map file only contains coefficient for certain chains. In the interface of "FFT" tool in Phenix or CCP4, there is an option to include a PDB file and define atom selections. It describe that "If a PDB is supplied, the output map will cover the model plus a buffer on all sides. The atom selection parameters can be used to specify a smaller region" . If I define the selection as chain A when I run the FFT, the output map still covers a rectangular block containing chain A, instead of regions only surrounding chain A. Thanks. Yu Zhang

3 4

CCN Jan 2012 article : find_alt_origin_sym_mate
by Bryan Lepore 17 Feb '12

17 Feb '12

will the find_alt_origin_sym_mate article in CCN Jan. 2012 be described in any other publications? -Bryan

2 2

MRage
by Graeme Winter 17 Feb '12

17 Feb '12

Hi Folks, Following from the newsletter article I am trying to test out phaser.MRage. I have a well solved case which I know is in the pdb and a sequence file: phaser.MRage hklin=data.mtz composition.component.sequence=sequence.pir symmetry_exploration=pointgroup mode=full search.services=ncbi composition.count=3 however it generates a second component then complains it knows nothing about this: Sorry: Molecular weight needed for component 2. Any suggestions how to get around this? Many thanks, Graeme [gw56@ws050 rage]$ phaser.MRage hklin=data.mtz composition.component.sequence=sequence.pir symmetry_exploration=pointgroup mode=full search.services=ncbi composition.count=3 ############################################################################### # MRage version 0.1.0 # ############################################################################### All configuration options: -------------------------- hklin = data.mtz labin = None resolution_cutoff = 2.5 crystal_symmetry { unit_cell = None space_group = None } mode = quick *full symmetry_exploration = *pointgroup enantiomorph dataset output { root = "mrage" max_solutions_to_write = 0 gui_base_dir = None save_aniso_data = False job_title = None } composition { count = 3 component { sequence = sequence.pir stoichiometry = 1 ensemble { coordinates { pdb = None identity = None } } model_collection { trim = False coordinates { pdb = None identity = None } } template { pdb = None alignment = None } homology { file_name = None max_hits = 3 } search { services = local ncbi max_hits = 3 } } component { sequence = None stoichiometry = 1 ensemble { coordinates { pdb = None identity = None } } model_collection { trim = False coordinates { pdb = None identity = None } } template { pdb = None alignment = None } homology { file_name = None max_hits = 3 } search { services = local *ncbi max_hits = 3 } } } queue { technology = lsf threading sge *multiprocessing pbs cpus = 1 submission_command = None qslot_cpus = 1 } packing_pool = 20 rotation_peaks_cutoff = 0.75 post_refinement_cutoff = 0.75 final_selection_cutoff = 0.75 b_factor_refinement = True significant_peak_threshold = 7.0 sculptor_protocols = 11 10 13 12 1 3 2 5 4 7 6 9 8 *all minimal template_equivalence = False exclude_pdb_ids = None simple_run { enable = False component_sequence = None template_model = None blast_services = local ncbi max_blast_hits = 3 } Sorry: Molecular weight needed for component 2.

2 2

AutoSol with 4.2A dataset for a protein/DNA complex
by Wei Shi 16 Feb '12

16 Feb '12

Hi everyone, I have got a 4.2A SeMet MAD dataset for a protein-DNA complex. And, the native dataset for this protein-DNA complex is ~3.2A. The space group for the native and SeMet crystals seem to be different. I am not sure whether it’s possible to solve the structure with the current data I have, and wondering whether any of you have experience with working with this low-resolution data and any suggestion for me. I processed the data with XDS in space group P31, and used *.cns.hkl file from XDSCONV as an input for AutoSol and also include the sequence for protein only. The protein dimer has 418 residues and DNA is 32bp. I run Autosol with the default setting. Below is statistics I got. It seems that I didn’t get anything promising. Any comment or suggestion about what to try next? Thank you so much! Statistics: Top solution: 2 Sites: 11. Space group: P32. FOM: 0.550. BAYES-CC: 8.10. Residues: 465 Side-chains: 0. Chains: 60. Model CC: 0.67 R-work: 0.4100 R-free: 0.4569. Under Heavy-atom search and phasing: Space group # of refined sites FOM Overall score R-factor Map skew Corr. of local RMS density Solution1 P31 11 0.530 8.10+/-11.80 0.4184 -0.12 0.66 Solution2 P32 11 0.550 8.10+/-11.80 0.3881 -0.10 0.66 Best, Wei

4 4

Comprehension of Orotidine 5'-Monophosphate Decarboxylase
by Kevin Jin 15 Feb '12

15 Feb '12

Dear all, I wrote a story for Orotidine 5'-Monophosphate Decarboxylase. http://www.jinkai.org/Enzymology.html Best, Kevin

1 0

Re: [phenixbb] qFit error in fixing alternate conformations
by Subhani Bandara 15 Feb '12

15 Feb '12

Hi, I used qFIT to fix the alternative conformations of my protein with a chelator complex, by submitting a PDB file and a mtz file. But it gave following error. What could be the reason for this. > > ___Run time error messages (if any):___ > xyz.pdb mtz.rfl FP SIGFP > Sorry: No matching array: refinement.input.xray_data.labels=FP,SIGFP > Thanks Subhani

3 3

Re: [phenixbb] Example datasets
by mohamed noor 15 Feb '12

15 Feb '12

Dear Phenix users Is there some examples datasets involving 3-wavelength MAD phasing available? I would like to learn from indexing to structure solution with a combination of CCP4 and Phenix if possible. Thanks.

2 1

cbf file
by Theresa H 15 Feb '12

15 Feb '12

Hi all Is there a utility to convert cbf file from Pilatus detector to mtz in Phenix? Thank you. Theresa

3 2

Re: [phenixbb] alternative conformation of residues
by Subhani Bandara 14 Feb '12

14 Feb '12

Hi all, I have a protein where three consecutive amino acids have alternative conformations. I edited the PDB file to have those altloc and made total occupancy of A and B to 1.00. But after refinement both A and B are overlapping and I could see the positive density for one conformation away from that (may be b'se I didn't change coordinates of B conformation). How can I move the B altloc in to the positive density. Do I have to edit the coordinates on PDB and if so how can Ido that? Thanks in advance for any help Subhani

4 3

problems when adding Free_R_flag
by G Y 14 Feb '12

14 Feb '12

Dear experts I use *Reflection file editor* in phenix GUI to generate Free_R_flag in my mtz file. The original input .mtz file contains arrays of FP SIGFP DANO SIGDANO and ISYM. I just simply click *COPY ALL ARRAYS* and tag on *Generation R free flags if not already present*, then run the software. The problem is that in the output .mtz from phenix I found the value of F and DANO becomes more or less same for each reflection. This is unreasonable for a reflection file. Phenix changed something on the columns of my .mtz file. How? Why? What should I do to keep my .mtz in correct and unchanged form? Thank you very much for your advice. The columns in the original input .mtz file look like H K L FP SIGFP DANO SIGDANO ISYM 0 0 12 319.30 2.64 2.23 5.27 0.00 0 0 16 424.00 3.50 -8.38 7.00 0.00 0 0 20 177.60 1.48 1.77 2.96 0.00 0 0 24 155.10 1.30 3.97 2.61 0.00 0 0 28 195.80 1.64 1.13 3.28 0.00 The output from phenix looks like (FP and DANO become similar in value for each reflection) H K L FP SIGFP DANO SIGDANO ISYM FreeRflag 0 0 12 320.41 3.73 318.19 3.73 0.00 0.00 0 0 16 419.81 4.95 428.19 4.95 0.00 0.00 0 0 20 178.48 2.09 176.72 2.09 0.00 0.00 0 0 24 157.09 1.85 153.11 1.85 0.00 0.00 0 0 28 196.37 2.32 195.23 2.32 0.00 0.00

2 1

Computation Crystallography Newsletter
by Nigel Moriarty 14 Feb '12

14 Feb '12

Folks The latest issue of the Computational Crystallography Newsletter is available on-line at http://www.phenix-online.org/newsletter for download. The articles are of general interest to protein crystallographers and are listed below. Enjoy Nigel Moriarty Articles CCTBX tools for derivative-free optimization Short communications phenix.find_alt_orig_sym_mate Using force field generated models in the refinement of crystallographic structures containing carbohydrates Viewing diffraction images in CCTBX On contribution of hydrogen atoms to X-ray scattering -- Nigel W. Moriarty, Ph.D. Building 64R0246B, Physical Biosciences Division Lawrence Berkeley National Laboratory Berkeley, CA 94720-8235 Phone : 510-486-5709 Email : NWMoriarty(a)LBL.gov Fax : 510-486-5909 Web : CCI.LBL.gov

1 0

Statistics from 'Scalepack' log file and 'Xtriage' log file
by Zhang yu 14 Feb '12

14 Feb '12

Dear Phenixer, What is the reason for the inconsistent data statistics from 'Scalpack' and 'Xtriage' ? I scaled my data with 'Scalepack' and got the following statistics (take completeness as an example) Shell I/Sigma in resolution shells: Lower Upper % of of reflections with I / Sigma less than limit limit 0 1 2 3 5 10 20 >20 total 40.00 8.93 0.1 0.2 0.4 0.9 1.5 22.6 97.3 0.0 97.3 8.93 7.10 0.8 1.7 2.7 4.1 7.1 35.8 99.2 0.0 99.2 7.10 6.20 2.0 4.6 7.6 10.9 18.4 56.6 99.5 0.0 99.5 6.20 5.64 2.9 6.5 11.1 16.3 27.5 65.0 99.0 0.0 99.0 5.64 5.24 4.1 8.2 13.7 19.2 33.0 67.3 97.4 0.0 97.4 5.24 4.93 4.3 9.4 14.8 19.9 33.1 67.6 96.1 0.0 96.1 4.93 4.68 5.2 10.1 15.9 21.8 33.9 67.8 95.6 0.0 95.6 4.68 4.48 5.4 11.2 17.6 24.7 37.8 69.0 94.5 0.0 94.5 4.48 4.31 5.8 11.0 18.1 25.1 39.8 71.2 94.0 0.0 94.0 4.31 4.16 6.4 14.3 23.6 32.7 47.2 73.6 93.7 0.0 93.7 4.16 4.03 8.2 16.7 27.2 36.7 53.0 76.5 93.1 0.0 93.1 4.03 3.91 9.3 20.5 32.4 42.6 57.8 79.1 93.5 0.0 93.5 3.91 3.81 9.6 23.1 37.2 47.7 61.4 81.6 93.6 0.0 93.6 3.81 3.72 11.6 26.5 41.3 51.7 66.1 84.5 92.9 0.0 92.9 3.72 3.63 11.6 30.9 47.8 58.4 71.0 86.5 93.7 0.0 93.7 3.63 3.55 14.9 34.4 50.7 62.0 74.3 88.9 94.5 0.0 94.5 3.55 3.48 15.4 37.1 54.7 64.6 76.2 89.5 93.4 0.0 93.4 3.48 3.42 17.2 41.5 60.1 69.4 79.6 90.8 94.0 0.0 94.0 3.42 3.36 18.3 44.6 62.3 70.9 79.7 89.4 92.1 0.0 92.1 3.36 3.30 20.8 46.9 64.2 71.9 79.7 88.3 90.3 0.0 90.3 All hkl 8.6 19.9 30.0 37.4 48.7 72.4 94.9 0.0 94.9 In summary, the overall completeness is 94.9%, while completeness of the lowest shell is close to 100%, and highest shell is 90.3%. But when I input the *.sca file into 'Xtriage', I got the following statistics (also completeness as an example). ---------------------------------------------------------------------------------------- | Res. Range | I/sigI>1 | I/sigI>2 | I/sigI>3 | I/sigI>5 | I/sigI>10 | I/sigI>15 | ---------------------------------------------------------------------------------------- | 40.02 - 8.19 | 51.1% | 50.9% | 50.7% | 50.2% | 38.9% | 5.1% | | 8.19 - 6.51 | 50.5% | 49.1% | 47.7% | 45.0% | 27.4% | 3.2% | | 6.51 - 5.69 | 49.0% | 45.7% | 42.9% | 37.1% | 18.0% | 1.4% | | 5.69 - 5.17 | 47.2% | 43.3% | 39.9% | 33.0% | 15.3% | 1.3% | | 5.17 - 4.80 | 45.8% | 41.6% | 38.4% | 31.6% | 14.6% | 1.2% | | 4.80 - 4.52 | 44.4% | 39.7% | 35.9% | 29.1% | 13.5% | 1.1% | | 4.52 - 4.29 | 43.4% | 38.2% | 33.6% | 26.4% | 11.5% | 0.8% | | 4.29 - 4.10 | 41.1% | 34.0% | 29.0% | 21.6% | 9.5% | 0.5% | | 4.10 - 3.95 | 36.1% | 29.2% | 24.6% | 18.5% | 7.6% | 0.3% | | 3.95 - 3.81 | 30.8% | 24.8% | 20.8% | 15.3% | 5.5% | 0.1% | | 3.81 - 3.69 | 27.4% | 21.6% | 17.7% | 12.4% | 3.8% | 0.0% | | 3.69 - 3.59 | 23.8% | 18.7% | 15.2% | 10.2% | 3.0% | 0.1% | | 3.59 - 3.49 | 20.3% | 15.5% | 12.6% | 8.3% | 1.9% | 0.0% | | 3.49 - 3.41 | 17.4% | 12.7% | 10.1% | 6.5% | 1.4% | 0.0% | ---------------------------------------------------------------------------------------- In summary, based on statistics from 'Xtriage', the data is quite incomplete, with only ~50% completeness even at lowest resolution shell. I convert the '*sca' into '*.mtz' file with "Reflection editor", and input the '*.mtz file' into 'Xtriage', I got another totally different statistics (completeness as an example) ---------------------------------------------------------------------------------------- | Res. Range | I/sigI>1 | I/sigI>2 | I/sigI>3 | I/sigI>5 | I/sigI>10 | I/sigI>15 | ---------------------------------------------------------------------------------------- | 39.67 - 8.19 | 96.5% | 96.2% | 95.8% | 94.9% | 74.0% | 10.0% | | 8.19 - 6.51 | 96.3% | 94.4% | 92.1% | 87.3% | 54.5% | 7.0% | | 6.51 - 5.69 | 92.6% | 88.1% | 83.3% | 72.7% | 36.2% | 3.5% | | 5.69 - 5.17 | 88.6% | 83.4% | 77.7% | 64.9% | 30.7% | 3.4% | | 5.17 - 4.80 | 85.6% | 80.0% | 74.8% | 62.3% | 29.4% | 3.3% | | 4.80 - 4.52 | 82.6% | 76.4% | 70.1% | 57.4% | 26.9% | 3.0% | | 4.52 - 4.29 | 80.6% | 73.4% | 65.7% | 52.3% | 23.2% | 2.2% | | 4.29 - 4.10 | 74.4% | 65.2% | 56.6% | 42.7% | 19.5% | 1.3% | | 4.10 - 3.95 | 64.2% | 55.7% | 48.2% | 36.7% | 15.5% | 1.0% | | 3.95 - 3.81 | 55.3% | 47.3% | 40.8% | 30.4% | 11.2% | 0.4% | | 3.81 - 3.69 | 48.7% | 40.9% | 34.7% | 24.8% | 8.1% | 0.2% | | 3.69 - 3.59 | 41.8% | 35.8% | 29.7% | 20.2% | 6.1% | 0.1% | | 3.59 - 3.49 | 35.3% | 29.4% | 24.5% | 16.6% | 4.1% | 0.0% | | 3.49 - 3.41 | 30.1% | 24.1% | 19.8% | 13.2% | 2.9% | 0.0% | ---------------------------------------------------------------------------------------- I am confused by the inconsistent statistics, could some explain it? Thanks. Yu

4 7

(no subject)
by intekhab alam 10 Feb '12

10 Feb '12

Hi all I have a 3A dataset for a protein-protein complex. I have successfully build the first protein and refined it to R/Rfree 24/28. I can see some density for my second protein but the density is a bit noisy. I have attached the coot image of the density. I want to model the aminoacid having sequence as given peptide: MGKKGKNKKGRGRPGVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADREREEELLERDEEEAIFGDGFGLE 1.Based on map features which segemnt should i start with. 2. Is there anyway that i can build the best fit segment of my second protein. I tried autobuild but it failed to build any peptide for my second protein. Your help is highly appreciated. regards -- INTEKHAB ALAM LABORATORY OF STRUCTURAL BIOINFORMATICS KOREA UNIVERSITY, SEOUL

3 2

phenix.ready_set
by Jianghai Zhu 10 Feb '12

10 Feb '12

Hi, I am using phenix.ready_set (version 1.7.3) to add hydrogens to my structure. I found out that it makes a few mistakes when dealing with glycans. It adds hydrogens to C1, O4, O3, O6 even when these atoms have formed covalent bonds with other sugars and residues. Subsequent phenix.refine aborts because of these incorrect hydrogens. However, when I use phenix.reduce directly, all hydrogens are placed correctly. I assume something went wrong in phenix.ready_set. The problem with phenix.reduce is that it doesn't know how to deal with ligand whereas phenix.ready_set does when a cif file is provided. -- Jianghai

5 6

sa_omit map calculation
by Ursula Schulze-Gahmen 08 Feb '12

08 Feb '12

I want to calculate a sa-omit map around the same small region in the 3 molecules in the au. I have 2 questions: Can I include the 3 regions in the same omit box file? What does the following advice in the manual mean: (Note: be sure to use the weights in both resolve_composite_map.mtz and omit_region.mtz). I am not sure what weights we are talking about? Thanks for any help. Ursula -- Ursula Schulze-Gahmen, Ph.D. Assistant Researcher UC Berkeley, QB3 356 Stanley Hall #3220 Berkeley, CA 94720-3220

2 1