- phenixbb - phenix-online.org

1.7.2 slow to open
by Jinsong Liu 12 Oct '11

12 Oct '11

Hi there, I wonder if there is anyone else experiencing a VERY VERY slow opening of the phenix GUI for the latest version of 1.7.2? We have RHEL 5.3 and CentOS 5.6, both machines show this. Most of the time, it will take minutes, sometime more than 10 minutes. There is no any warning or error message, after the long waiting the GUI will suddenly show up. In the older version, it usually takes seconds to load the GUI. Thanks. Jinsong -- Jinsong Liu, Ph.D. Principle Investigator & Head of Laboratory of Structural Biology Guangzhou Institute of Biomedicine and Health (GIBH) Chinese Academy of Sciences Guangzhou ( Canton ) 510630, China Phone: 86-20-32015317 (Office) E-mail: liu_jinsong(a)gibh.ac.cn

2 2

Re: [phenixbb] mr_rosetta
by Thomas C. Terwilliger 11 Oct '11

11 Oct '11

Hi Abhinav, This format is very unforgiving. It has to have exactly 5 lines: ## TARGET SP_3n91 # hhsearch scores_from_program: 0 1.00 0 --DDDEVTMNSK.... 0 GSDNEFPDFDYQ.... -- also note I changed SP 3n91 to SP_3n91. Your PDB file name must also start with SP_3n91 in this case. You need a pdb file name with at least 5 chars before the ".pdb" and these 5 characters have to match the 5 characters after TARGET on the first line. Note that the other format read by mr_rosetta is a lot easier: > title text for sequence of target to follow VDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD > title text for sequence of template (supplied PDB) to follow -AFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEIT--TMDG All the best, Tom T >> Somebody helped me out with the format. Thanks. >> My alignment file looks like: >> ## SP 3n91 >> >> >> 0 --DDDEVTMNSK.... >> 0 GSDNEFPDFDYQ.... >> >> >> >> But phenix says >> >> ******************* ERROR ENDING *************** >> >> Sorry, the alignment file ['xx.ali'] >> does not seem to have the correct format? >> It can either start with '##' or with '> title of target seq here' >> >> ******************* ERROR ENDING *************** >> >> I do have the file starting with '##'! >> >> Thanks, >> Abhinav >> >> JCSG@SSRL, SLAC >> Phone: (650) 926-2992 >> Fax: (650) 926-3292 >> >> >> On 10/11/2011 12:23 PM, Abhinav Kumar wrote: >>> Hi, >>> >>> I am looking for file format for alignment file (*.ali) used in >>> mr_rosetta. >>> The description on the Phenix web site is not clear. >>> Can someone please describe the file format with an example? >>> -- >>> >>> Thanks, >>> Abhinav >>> >>> JCSG@SSRL, SLAC >>> Phone: (650) 926-2992 >>> Fax: (650) 926-3292 >>> >> _______________________________________________ >> phenixbb mailing list >> phenixbb(a)phenix-online.org >> http://phenix-online.org/mailman/listinfo/phenixbb >>

2 2

Re: [phenixbb] mr_rosetta
by Thomas C. Terwilliger 11 Oct '11

11 Oct '11

Hi Abhinav, Here is an example. > cat WORK_1/alignment.ali ## TARGET coord # hhsearch scores_from_program: 0 1.00 0 AQLMDMRD 0 AQLMDMRD -- (the -- at the end is included in the file) You can also use one with just 4 lines (sculptor format): > title text for sequence of target to follow VDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD > title text for sequence of template (supplied PDB) to follow -AFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEIT--TMDG All the best, Tom T >> Hi, >> >> I am looking for file format for alignment file (*.ali) used in >> mr_rosetta. >> The description on the Phenix web site is not clear. >> Can someone please describe the file format with an example? >> -- >> >> Thanks, >> Abhinav >> >> JCSG@SSRL, SLAC >> Phone: (650) 926-2992 >> Fax: (650) 926-3292 >> >> _______________________________________________ >> phenixbb mailing list >> phenixbb(a)phenix-online.org >> http://phenix-online.org/mailman/listinfo/phenixbb >>

1 0

mr_rosetta
by Abhinav Kumar 11 Oct '11

11 Oct '11

Hi, I am looking for file format for alignment file (*.ali) used in mr_rosetta. The description on the Phenix web site is not clear. Can someone please describe the file format with an example? -- Thanks, Abhinav JCSG@SSRL, SLAC Phone: (650) 926-2992 Fax: (650) 926-3292

1 1

Re: [phenixbb] phenix.mr_rosetta not running "prerefine"
by Thomas C. Terwilliger 11 Oct '11

11 Oct '11

Hi Laurie, The problem is that mr_rosetta needed a pdb file name with more than 4 characters before the ".pdb" for this shortcut of generating pre-refined models to work (the Rosetta routine requires a longer file name). So if you rename your PDB file this should run (it does on my machine.) I will fix mr_rosetta so that it can take your PDB file. All the best, Tom T >> On Tue, Oct 11, 2011 at 12:33 PM, Thomas C. Terwilliger < >> terwilliger(a)lanl.gov> wrote: >> >>> Hi Laurie, >>> >>> Yes, it is not doing anything. There is something that didn't work in >>> the >>> inputs. Can you send me your fasta and PDB files and I'll just run it >>> here >>> to see what is wrong? >>> >>> Thanks! >>> -Tom T >>> >>> >> OK - I am also sending: >>> >> >>> >> >>> /netscr/bettsl/rosetta_test/MR_ROSETTA_2/GROUP_OF_PLACE_MODEL_1/RUN_1/REBUILD_IN_SETS_1/RUN_1/WORK_1/rebuild.log >>> >> >>> >> On Tue, Oct 11, 2011 at 12:01 PM, Thomas C. Terwilliger < >>> >> terwilliger(a)lanl.gov> wrote: >>> >> >>> >>> Hi Laurie, >>> >>> >>> >>> Yes, something didn't work it all right. Can you send me, off-list, >>> this >>> >>> log file: >>> >>> >>> >>> >>> >>> >>> /netscr/bettsl/rosetta_test/MR_ROSETTA_1/GROUP_OF_PLACE_MODEL_1/RUN_1/REBUILD_IN_SETS_1/RUN_FILE_1.log >>> >>> >>> >>> which I am guessing has some kind of error message in it. >>> >>> >>> >>> Thanks! >>> >>> -Tom T >>> >>> >>> >>> >> Hi - I tried the little prerefine without any data script in your >>> >>> >> documentation - I don't think it's working right. I attach the >>> >>> script >>> >>> >> file >>> >>> >> that I made (prerefine.dat) and the RUN_FILE_1.log. >>> >>> >> >>> >>> >> I can send more info offline if need be. >>> >>> >> >>> >>> >> Thanks >>> >>> >> >>> >>> >> LAurie Betts >>> >>> >> _______________________________________________ >>> >>> >> phenixbb mailing list >>> >>> >> phenixbb(a)phenix-online.org >>> >>> >> http://phenix-online.org/mailman/listinfo/phenixbb >>> >>> >> >>> >>> >>> >>> _______________________________________________ >>> >>> phenixbb mailing list >>> >>> phenixbb(a)phenix-online.org >>> >>> http://phenix-online.org/mailman/listinfo/phenixbb >>> >>> >>> >> >>> >>> >>

1 0

refinements settings .eff
by Christian Roth 11 Oct '11

11 Oct '11

Hi Phenix gurus, I have done a refinement with an sodium ion. I had generated a phil file for the distance restraints to the surrounding water. Now i am not sure if it is really there. I removed it and removed the phil from the list in the gui. Now phenix complains about no Atom selected and stops. In the .eff file all restraints are incorporated and in I deleted therefore the geometric restraints manually from the . eff file. As a consequence an unused parameter warning appears about unused parameters or spelling errors in the input file. I guess the .eff file. My default parameter folder is empty. Does phenix load the .eff file from the previous run and would it help to remove this? I dont wanne start a new project just to be in the default configuration mode without additional information in the .eff file. I did this using the gui so I am not sure how to incorporate the --unused_ok command to which may help to convince phenix to process the job. I hope it is clear what I mean and thanks for any suggestion. Christian

2 1

phenix.mr_rosetta not running "prerefine"
by Laurie Betts 11 Oct '11

11 Oct '11

Hi - I tried the little prerefine without any data script in your documentation - I don't think it's working right. I attach the script file that I made (prerefine.dat) and the RUN_FILE_1.log. I can send more info offline if need be. Thanks LAurie Betts

2 1

Simulated annealing composite omit map conversion
by Yuri 11 Oct '11

11 Oct '11

The figures are good illustration of what seems to be the consensus: Finely sampled maps can represent the best mathematical approximation of the continuous electron density function. The weirdness I referred to probably has more to do with what Nathaniel alluded to previously. The fact that our eyes get so used to staring at coarse pointy density - caused by the default grid of building programs (in the case of "on the fly" map generation from coefficients). That of course can be changed if one changes the sampling rate and get their eyes used to the new look. that I suppose would become your new norm. -- Yuri Pompeu

1 0

MR_Rosetta and dimer of heterodimer
by Morten Grøftehauge 11 Oct '11

11 Oct '11

Hi everybody, I'm trying to phase a dimer of a heterodimer of a large, ~700aa, and small, ~150aa, component. The only good search model according to HHpred covers the first 500aa of the large component. So I am wondering whether I should add the 150aa to the end of the sequence file and add them to the fragment files in order for phenix.mr_rosetta to do density modification correctly? Or does this not matter at all? According to HHpred and others the last 200aa are beta sheets, probably a a beta sandwich or two, and the 150aa component consists of helical elements but that is as close as it really gets. Cheers, Morten

2 1

Re: [phenixbb] Simulated annealing composite omit map conversion
by Yuri 11 Oct '11

11 Oct '11

hi Nathaniel, Thats simple enough... Do I have any control over grid ( make a tighter looking mesh for publication) -- Yuri Pompeu

8 9