Hi Yarrow, have you done what I suggested in my yesterday's email: update to the latest PHENIX version: http://www.phenix-online.org/download/ ? If not, then please so it and then everything should work. Pavel. On 8/3/10 10:57 AM, [email protected] wrote:
Hello Pavel,
The averaged kicked map looks great! I am able to see loop density that I could not see before. However, I still have one question:
The kicked map were created when I put the map parameters in my custom_par file however, I was unable to run Phenix.maps in the command line. When I do this I get a message "Not implemented". I would like to create a ccp4 map for viewing in pymol without running refinement again. Do you know what could be causing this message? If I create "maps.params" by inserting the commands from the .def file Phenix does not recognize this file format. Any help would be appreciated. Thank you.
-Yarrow
Send phenixbb mailing list submissions to [email protected]
To subscribe or unsubscribe via the World Wide Web, visit http://phenix-online.org/mailman/listinfo/phenixbb or, via email, send a message with subject or body 'help' to [email protected]
You can reach the person managing the list at [email protected]
When replying, please edit your Subject line so it is more specific than "Re: Contents of phenixbb digest..."
Today's Topics:
1. syntax for Averaged Kicked maps and maps.param ([email protected]) 2. Re: syntax for Averaged Kicked maps and maps.param (Pavel Afonine) 3. Re: Phenix Autobuild (Thomas C. Terwilliger) 4. New version complaint (Simon Kolstoe) 5. Re: New version complaint (Nathaniel Echols) 6. Re: New version complaint (Douglas Jacobsen) 7. Re: New version complaint (Nathaniel Echols) 8. Adequate size for Free R test set? (Joseph Noel)
----------------------------------------------------------------------
Message: 1 Date: Mon, 2 Aug 2010 17:38:05 -0700 From: [email protected] To: [email protected] Subject: [phenixbb] syntax for Averaged Kicked maps and maps.param Message-ID:
Content-Type: text/plain;charset=iso-8859-1 Hello,
Disclaimer: I am a newbie to both crystallagraphy and Phenix.
I am running phenix.refine (v1.6-289) in the command line
1. I want to make averaged "kicked-maps" but I keep getting a syntax error. I tried renaming "maps.param" but this file was not recognized.
2. When I enter Phenix.maps into the command line I get a message that syas "not implemented" I am trying to get the latest versiou of phenix installed.
The following is the syntax I put in my custom_params file Thanks
-Yarrow
refinement.main.number_of_macro_cycles = 2 #refinement.main.fix_rotamers = True refinement.refine.strategy = individual_sites+individual_adp refinement.output.prefix = CIN4_refine_omit refinement.output.serial = 12 refinement.output.write_def_file = True refinement.target_weights_wxc.scale = 0.2 refinement.main.max_number_of_interations=15
refinement.electron_density_maps { map { mtz_label_amplitudes = "2FOFCWT_kick" mtz_label_phases = "PH2FOFCWT_kick" likelihood_weighted = True obs_factor = 2 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = True } map { mtz_label_amplitudes = "FOFCWT_kicked" mtz_label_phases = "PHFOFCWT_kicked" likelihood_weighted = True obs_factor = 1 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = false }
------------------------------
Message: 2 Date: Mon, 02 Aug 2010 17:48:45 -0700 From: Pavel Afonine
To: PHENIX user mailing list Subject: Re: [phenixbb] syntax for Averaged Kicked maps and maps.param Message-ID:<[email protected]> Content-Type: text/plain; charset=ISO-8859-1; format=flowed Hi Yarrow,
you can use GUI or the command line for doing this.
0) It would be best if you update to the latest version, although I believe it might work with the one you have too:
http://www.phenix-online.org/download/
1) GUI: launch PHENIX GUI and go to Maps -> Create Maps. then just add as many maps you want (or use pre-defined ones) and check a box for kick map.
2) From the command line type:
phenix.maps
and hit Enter (Return). That will create a file called something maps.params. Edit that file to add/remove the maps you need/ don't need and set
kicked = True
for the one you want to be "kicked", and then run
phenix.maps maps.params
Let me know if you have any questions or problems.
Good luck! Pavel.
On 8/2/10 5:38 PM, [email protected] wrote:
Hello,
Disclaimer: I am a newbie to both crystallagraphy and Phenix.
I am running phenix.refine (v1.6-289) in the command line
1. I want to make averaged "kicked-maps" but I keep getting a syntax error. I tried renaming "maps.param" but this file was not recognized.
2. When I enter Phenix.maps into the command line I get a message that syas "not implemented" I am trying to get the latest versiou of phenix installed.
The following is the syntax I put in my custom_params file Thanks
-Yarrow
refinement.main.number_of_macro_cycles = 2 #refinement.main.fix_rotamers = True refinement.refine.strategy = individual_sites+individual_adp refinement.output.prefix = CIN4_refine_omit refinement.output.serial = 12 refinement.output.write_def_file = True refinement.target_weights_wxc.scale = 0.2 refinement.main.max_number_of_interations=15
refinement.electron_density_maps { map { mtz_label_amplitudes = "2FOFCWT_kick" mtz_label_phases = "PH2FOFCWT_kick" likelihood_weighted = True obs_factor = 2 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = True } map { mtz_label_amplitudes = "FOFCWT_kicked" mtz_label_phases = "PHFOFCWT_kicked" likelihood_weighted = True obs_factor = 1 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = false }
_______________________________________________ phenixbb mailing list [email protected] http://phenix-online.org/mailman/listinfo/phenixbb
------------------------------
Message: 3 Date: Tue, 3 Aug 2010 07:26:46 -0600 (MDT) From: "Thomas C. Terwilliger"
To: "Md. Munan Shaik" Cc: [email protected] Subject: Re: [phenixbb] Phenix Autobuild Message-ID:<[email protected]> Content-Type: text/plain;charset=iso-8859-1 Hi Munan Shaik,
Phenix autobuild can read several types of sequence files, but the basic format is very simple: enter one copy of the sequence of each chain, separated by a blank line or a line starting with ">" between chains. You can optionally add any lines starting with ">" which will be ignored. So here is an example:
alpha subunit (type 1) MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAENPSTALHKVSELYDRL GFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANAYAQTLGTIFTEQPKPYEV EICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTTEPIATAMRESYRADLDLEAA VGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRRAFRRIAGTALEQLVPAEPAAAS ESAPEPKPDTETKPADTQD beta subunit (type 1) MTADRPALRTGDRDTRLSFGSNLSSFTDYLRGHAPELLPENRIGHRSHSTRGGDGMESGD LAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDEYSAAGIAGTAGIAIEL VRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAMQGLAVVPLLVGYDLDADDES RAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKIYSPDSDEETALRAAIESLYDAA DDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARRIVAERTEQGGSAR
Please let me know if that doesn't do it!
All the best, Tom T
Hi everybody, I have a problem with Phenix autobuild. I want to input sequence file together with the pdb and mtz that I got from molecular replacement. But I have no idea which types of sequence files its required. if anybody please help me out.
thanks =================================================== Md. Munan Shaik Department of Chemical Biology University of Padova via G. Colombo 03 Padova 35131, Italy
------------------------------
Message: 4 Date: Tue, 3 Aug 2010 15:31:46 +0100 From: Simon Kolstoe
To: PHENIX user mailing list Subject: [phenixbb] New version complaint Message-ID:<[email protected]> Content-Type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Hi there,
I've been using version 1.6.2-432 on a Macbook and was particularly enjoying the "Show Histograms" button on the POLYGON results page. However today I updated to version 1.6.4-486 using the dmg installer, and that useful option has disappeared! Is there a good reason for the absence of this function, and if not can we get it back?
Thanks,
Simon
--------------------------------------------------------------- Dr Simon Kolstoe Laboratory for Protein Crystallography Centre for Amyloidosis& Acute Phase Proteins UCL Medical School Rowland Hill Street, London NW3 2PF
Tel: 020 7433 2765 http://www.ucl.ac.uk/~rmhasek --------------------------------------------------------------
------------------------------
Message: 5 Date: Tue, 3 Aug 2010 07:39:11 -0700 From: Nathaniel Echols
To: PHENIX user mailing list Subject: Re: [phenixbb] New version complaint Message-ID: Content-Type: text/plain; charset="iso-8859-1" On Tue, Aug 3, 2010 at 7:31 AM, Simon Kolstoe
wrote: I've been using version 1.6.2-432 on a Macbook and was particularly enjoying the "Show Histograms" button on the POLYGON results page. However today I updated to version 1.6.4-486 using the dmg installer, and that useful option has disappeared! Is there a good reason for the absence of this function, and if not can we get it back?
There is a reason, but not a good one. I'll fix it later today. FYI, the "PDB Statistics" tool offers another way to view histograms, although it requires that you manually specify the resolution range.
-Nat