Python-based Hierarchical ENvironment for Integrated Xtallography |
Documentation Home |
Automated structure solution with AutoSol
Author(s)
PurposeThe AutoSol Wizard uses HYSS, SOLVE, Phaser, RESOLVE, xtriage and phenix.refine to solve a structure and generate experimental phases with the MAD, MIR, SIR, or SAD methods. The Wizard begins with datafiles (.sca, .hkl, etc) containing amplitidues (or intensities) of structure factors, identifies heavy-atom sites, calculates phases, carries out density modification and NCS identification, and builds and refines a preliminary model. UsageThe AutoSol Wizard can be run from the PHENIX GUI, from the command-line, and from parameters files. All three versions are identical except in the way that they take commands from the user. See Using the PHENIX Wizards for details of how to run a Wizard. The command-line version will be described here, except for MIR and multiple datasets, which can only be run with the GUI or with a parameters file. The GUI is documented separately. How the AutoSol Wizard worksThe basic steps that the AutoSol Wizard carries out are described below. They are: Setting up inputs, Analyzing and scaling the data, Finding heavy-atom (anomalously-scattering atom) sites, Scoring of heavy-atom solutions, Phasing, Density modification (including NCS averaging), and Preliminary model-building and refinement. The data for structure solution are grouped into Datasets and solutions are stored in Solution objects. Setting up inputsThe AutoSol Wizard expects the following basic information: (1) a datafile name (w1.sca or data=w1.sca) (2) a sequence file (seq.dat or seq_file=seq.dat) (3) how many sites to look for (2 or sites=2) (4) what the anomalously-scattering atom is (Se or atom_type=Se) (5) It is helpful to add the wavelength and f_prime and f_double_prime for each wavelength or derivative that you have as well You can also specify many other parameters, including resolution, number of sites, whether to search in a thorough or quick fashion, how thoroughly to build a model, etc. If you have a heavy-atom solution from a previous run or another approach, you can read it in directly as well. Your parameters can be specified on the command-line, using a GUI, or by editing a parameters file (examples below). Datafile formats in AutoSolAutoSol will accept the following formats of data:
The data from any of these formats will be converted to amplitudes (F+ , sigF+, and F-, sigF-) internally. For the best scaling results, you should supply all scalepack unmerged original index files or all mtz unmerged files. If all the files are scalepack unmerged original index or all the files are mtz unmerged and no anisotropy correction is applied, then SOLVE local scaling will be applied to the data prior to merging and averaging equivalent reflections. In all other cases equivalent reflections will be averaged prior to scaling, so that the scaling may not be as effective at removing systematic errors due to absorption or other effects. Sequence file formatThe sequence file for autosol (and autobuild) is the one-letter code sequence of each chain in the structure to be solved, where chains are separated by blank lines or lines starting with a > character. Here is a simple example with two different chains: << sequence of chain A follows. This line not required LVLKWVMSTKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFT << sequence of chain B follows. This line could be blank to indicate new chain AQILSVSGDVIQLMDMRDYKTIEVPMKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVKG Usually the chain type (RNA, DNA, PROTEIN) is guessed from the sequence file. You can also specify it directly with a command such as chain_type=PROTEIN. If there are multiple copies of a chain (ncs) then you can put in a single copy and it will be used for all of them. If there are multiple copies of a set of chains (A,A,A, B,B,B would be 3 copies of chains A and B) then you can put in the unique set (A and B). If there are different numbers of copies of different chains, then put in the relative number of copies of each chain (for a structure with 2 copies of A and one of B, put in A,A,B; for a structure with 4 of A and 2 B put in either (A,A,A,A,B,B) or (A,A,B). The solvent content will be calculated from the value of ncs_copies and the sequences and stoichiometry defined by your sequence file. If you specify ncs_copies=nn then nn will be used for ncs_copies; otherwise ncs_copies will be guessed from the composition in your sequence file, with the contents of the asymmetric unit being calculated as ncs_copies copies of the contents of your sequence file. If you have more than one type of chain (RNA, DNA, PROTEIN) then just put in the sequence for the one that is the biggest, and be sure to specify solvent_fraction=xxx so that the correct solvent fraction is used. Datasets and Solutions in AutoSolAutoSol breaks down the data for a structure solution into datasets, where a dataset is a set of data that corresponds to a single set of heavy-atom sites. An entire MAD dataset is a single dataset. An MIR structure solution consists of several datasets (one for each native-derivative combination). A MAD + SIR structure has one dataset for the MAD data and a second dataset for the SIR data. The heavy-atom sites for each dataset are found separately (but using difference Fouriers from any previously-solved datasets to help). In the phasing step all the information from all datasets is merged into a single set of phases. The AutoSol wizard uses a "Solution" object to keep track of heavy-atom solutions and the phased datasets that go with them. There are two types of Solutions: those which consist of a single dataset (Primary Solutions) and those that are combinations of datasets (Composite Solutions). "Primary" Solutions have information on the datafiles that were part of the dataset and on the heavy-atom sites for this dataset. Composite Solutions are simply sets of Primary Solutions, with associated origin shifts. The hand of the heavy-atom or anomalously-scattering atom substructure is part of a Solution, so if you have two datatsets, each with two Solutions related by inversion, then AutoSol would normally construct four different Composite Solutions from these and score each one as described below. Analyzing and scaling the dataThe AutoSol Wizard analyzes input datasets with phenix.xtriage to identify twinning and other conditions that may require special care. The data is scaled with SOLVE. For MAD data, FA values are calculated as well. Note on anisotropy corrections: The AutoSol wizard will apply an anistropy correction and B-factor sharpening to all the raw experimental data by default (controlled by they keyword remove_aniso=True). The target overall Wilson B factor can be set with the keyword b_iso, as in b_iso=25. By default the target Wilson B will be 10 times the resolution of the data (e.g., if the resolution is 3 A then b_iso=30.), or the actual Wilson B of the data, whichever is lower. If an anisotropy correction is applied then the entire AutoSol run will be carried out with anisotropy-corrected and sharpened data. At the very end of the run the final model will be re-refined against the uncorrected refinement data and this re-refined model and the uncorrected refinement data (with freeR flags) will be written out. For the top solution this will be as overall_best.pdb and overall_best_refine_data.mtz; for all other solutions the files will be listed at the end of the log file. Finding heavy-atom (anomalously-scattering atom) sitesThe AutoSol Wizard uses HYSS to find heavy-atom sites. The result of this step is a list of possible heavy-atom solutions for a dataset. For SIR or SAD data, the isomorphous or anomalous differences, respectively are used as input to HYSS. For MAD data, the anomalous differences at each wavelength, and the FA estimates of complete heavy-atom structure factors from SOLVE are each used as separate inputs to HYSS. Each heavy-atom substructure obtained from HYSS corresponds to a potential solution. In space groups where the heavy-atom structure can be either hand, a pair of enantiomorphic solutions is saved for each run of HYSS. Running AutoSol separately in related space groupsAutoSol will check for the opposite hand of the heavy-atom solution, and at the same time it will check for the opposite hand of your space group (It will invert the heavy-atom solution from HYSS and invert the hand of the space group at the same time). Therefore you do not need to run AutoSol twice for space groups that are chiral (for example P41). The corresponding inverse space groups will be checked automatically (P43 ). If there are possibilities for your space group other than the inverse hand of the space group, then you should test them all, one at a time. For example if you were not able to measure 00l reflections in a hexagonal space group, your space group might be P6, P61, P62, P63, P64 or P65. In this case you would have to run it in P6, P61 P62 and P63 (and then P65 and P64 will be done automatically as the inverses of P61 and P62). Normally only one of these will give a plausible solution. Scoring of heavy-atom solutionsPotential heavy-atom solutions are scored based on a set of criteria (SKEW, CORR_RMS, CC_DENMOD, RFACTOR, NCS_OVERLAP,TRUNCATE, REGIONS, CONTRAST, FOM, FLATNESS, described below), using either a Bayesian estimate or a Z-score system to put all the scores on a common scale and to combine them into a single overall score. The overall scoring method chosen (BAYES-CC or Z-SCORE) is determined by the value of the keyword overall_score_method. The default is BAYES-CC. Note that for all scoring methods, the map that is being evaluated, and the estimates of map-perfect-model correlation, refer to the experimental electron density map, not the density-modified map. Bayesian CC scores (BAYES-CC). Bayesian estimates of the quality of experimental electron density maps are obtained using data from a set of previously-solved datasets. The standard scoring criteria were evaluated for 1905 potential solutions in a set of 246 MAD, SAD, and MIR datasets. As each dataset had previously been solved, the correlation between the refined model and each experimental map (CC_PERFECT) could be calculated for each solution (after offsetting the maps to account for origin differences). Histograms were tabulated of the number of instances that a scoring criterion (e.g., SKEW) had various possible values, as a function of the CC_PERFECT of the corresponding experimental map to the refined model. These histograms yield the relative probability of measuring a particular value of that scoring criterion (SKEW), given the value of CC_PERFECT. Using Bayes' rule, these probabilities can be used to estimate the relative probabilities of values of CC_PERFECT given the value of each scoring criterion for a particular electron density map. The mean estimate (BAYES-CC) is reported (multiplied x 100), with a +/-2SD estimate of the uncertainty in this estimate of CC_PERFECT. The BAYES-CC values are estimated independently for each scoring criterion used, and also from all those selected with the keyword score_type_list and not selected with the keyword skip_score_list. Z-scores (Z-SCORE). The Z-score for one criterion for a particular solution is given by, Z= (Score - mean_random_solution_score)/(SD_of_random_solution_scores)where Score is the score for this solution, mean_random_solution_score is the mean score for a solution with randomized phases, and SD_of_random_solution_scores is the standard deviation of the scores of solutions with randomized phases. To create a total score based on Z-scores, the Z-scores for each criterion are simply summed. The principal scoring criteria are: The skew (SKEW; third moment or normalized <rho**3>) of the density in an electron density map is a good measure of its quality, because a random map has a skew of zero (density histograms look like a Gaussian), while a good map has a very positive skew (density histograms very strong near zero, but many points with very high density). This criterion is used in scoring by default. Correlation of local rms density (CORR_RMS). The presence of contiguous flat solvent regions in a map was detected using the correlation coefficient of the smoothed squared electron density calculated as described above, with the same quantity calculated using half the value of the smoothing radius, yielding the correlation of rms density, r2RMS. In this way the local value of the rms density within a small local region (typically within a radius of 3 A) is compared with the local rms density in a larger local region (typically within a radius of 6 A). If there were a large, contiguous solvent region and another large contiguous region containing the macromolecule, the local rms density in the small region would be expected to be highly correlated with the rms density in the larger region. On the other hand, if the solvent region were broken up into many small flat regions, then this correlation would be expected to be smaller. Correlation of map-phased electron density map with experimentally- phased map (CC_DENMOD). The statistical density modification in RESOLVE allows the calculation of map-based phases that are (mostly) independent of the experimental phases. The phase information in statistical density modification comes from two sources: your experimental phases and maximization of the agreement of the map with expectations (such as a flat solvent region). Normally the phase probabilities from these two sources are merged together, yielding your density-modified phases. This score is calculated based on the correlation of the phase information from these two sources before combining them, and is a good indication of the quality of the experimental phases. This criterion is used in scoring by default. The R-factor for density modification (RFACTOR). Statistical density modification provides an estimate of structure factors that is (mostly) independent of the measured structure factors, so the R-factor between FC and Fobs is a good measure of the quality of experimental phases. This criterion is used in scoring by default. Non-crystallographic symmetry (NCS_OVERLAP). The presence of NCS in a map is a nearly-positive indication that the map is good, or has some correct features. The AutoSol Wizard uses symmetry in heavy-atom sites to suggest NCS, and RESOLVE identifies the actual correlation of NCS-related density for the NCS overlap score. This score is used by default if NCS is present in the Z-score method of scoring. Figure of merit (FOM). The figure of merit of phasing is a good indicator of the internal consistency of a solution. This score is not normalized by the SD of randomized phase sets (as that has no meaning; rather a standard SD=0.05 is used). This score is used by default if NCS is present in the Z-score method of scoring and in the Bayesian CC estimate method. Map correlation after truncation (TRUNCATION). Dummy atoms (the same number as estimated non-hydrogen atoms in the structure) are placed in positions of high density of the map, and a new map is calculated based on these atomic positions. The correlation of these maps is calculated after adjusting an overall B-value for the dummy atoms to maximize the correlation. A good map will show a high correlation of these maps. This score is by default not used. Number of contiguous regions per 100 A**3 comprising top 5% of density in map (REGIONS). The top 5% of points in the map are marked, and the number of contiguous regions that result are counted, and divided by the volume of the asymmetric unit, then multiplied by 100. A good map will have just a few contiguous regions at a high contour level, a poor map will have many isolated peaks. This score is by default not used. Contrast, or standard deviation of local rms density (CONTRAST). The local rms density in the map is calculated using a smoothing radius of 3 times the high-resolution cutoff (or 6 A, if less than 6A). Then the standard deviation of the local rms, normalized to the mean value of the local rms, is reported. This criteria will be high if there are regions of high local rms (the macromolecule) and separate regions of low local rms (the solvent) and low if the map is random. This score is by default not used. PhasingThe AutoSol Wizard uses Phaser to calculate experimental phases from SAD data, and SOLVE to calculate phases from MIR, MAD, and multiple-dataset cases. Density modification (including NCS averaging)The AutoSol Wizard uses RESOLVE to carry out density modification. It identifies NCS from symmetries in heavy-atom sites with RESOLVE and applies this NCS if it is present in the electron density map. Preliminary model-building and refinementThe AutoSol Wizard carries out one cycle of model-building and refinement after obtaining density-modified phases. The model-building is done with RESOLVE. The refinement is carried out with phenix.refine. Resolution limits in AutoSolThere are several resolution limits used in AutoSol. You can leave them all to default, or you can set any of them individually. Here is a list of these limits and how their default values are set: Output files from AutoSolWhen you run AutoSol the output files will be in a subdirectory with your run number: AutoSol_run_1_/ The key output files that are produced are:
How to run the AutoSol WizardRunning the AutoSol Wizard is easy. From the command-line you can type: phenix.autosol w1.sca seq.dat 2 Se f_prime=-8 f_double_prime=4.5 The AutoSol Wizard will assume that w1.sca is a datafile (because it ends in .sca and is a file) and that seq.dat is a sequence file, that there are 2 heavy-atom sites, and that the heavy-atom is Se. The f_prime and f_double_prime values are set explicitly You can also specify each of these things directly: phenix.autosol data=w1.sca seq_file=seq.dat sites=2 \ atom_type=Se f_prime=-8 f_double_prime=4.5 You can specify many more parameters as well. See the list of keywords, defaults and descriptions at the end of this page and also general information about running Wizards at Using the PHENIX Wizards for how to do this. Some of the most common parameters are: sites=3 # 3 sites sites_file=sites.pdb # ha sites in PDB or fractional xyz format atom_type=Se # Se is the heavy-atom seq_file=seq.dat # sequence file (1-aa code, separate chains with >>>>) quick=True # try to find sites quickly data=w1.sca # input datafile lambda=0.9798 # wavelength for SAD Running from a parameters fileYou can run phenix.autosol from a parameters file. This is often convenient because you can generate a default one with: phenix.autosol --show_defaults > my_autosol.effand then you can just edit this file to match your needs and run it with: phenix.autosol my_autosol.effNOTE: the autosol parameters file my_autosol.eff will have just one blank native, derivative, and wavelength. You can cut and paste them to put in as many as you want to have. Model viewing during model-building with the Coot-PHENIX interfaceThe AutoSol Wizard allows you to view the current best model that is produced by the automated model-building process. This capability is identical to the view/edit model procedure available in the AutoBuild Wizard. Normally you would use it just to view the model in AutoSol, and to view and edit a model in AutoBuild . The PHENIX-Coot interface is accessible via the command-line. When a model has been produced by the AutoSol Wizard, you can open a new window and type: phenix.autobuild cootwhich will start Coot with your current map and model. When Coot has been loaded, your map and model will be displayed along with a PHENIX-Coot Interface window. If you want, you can edit your model and then save it, giving it back to PHENIX with the button labelled something like Save model as COMM/overall_best_coot_7.pdb. This button creates the indicated file and also tells PHENIX to look for this file and to try and include the contents of the model in the building process. In AutoSol, only the main-chain atoms of the model you save are considered, and the side-chains are ignored. Ligands and solvent in the model are ignored as well. As the AutoSol Wizard continues to build new models and create new maps, you can update in the PHENIX-Coot Interface to the current best model and map with the button Update with current files from PHENIX. ExamplesSAD datasetphenix.autosol w1.sca seq.dat 2 Se lambda=0.9798The sequence file is used to estimate the solvent content of the crystal and for model-building. The wavelength (lambda) is used to look up values for f_prime and f_double_prime from a table, but if measured values are available from a fluorescence scan, these should be given in addition to the wavelength. SAD dataset specifying solvent fractionphenix.autosol w1.sca seq.dat 2 Se lambda=0.9798 \ solvent_fraction=0.45This will force the solvent fraction to be 0.45. This illustrates a general feature of the Wizards: they will try to estimate values of parameters, but if you input them directly, they will use your input values. SAD dataset without model-buildingphenix.autosol w1.sca seq.dat 2 Se lambda=0.9798 \ build=FalseThis will carry out the usual structure solution, but will skip model-building SAD dataset, building RNA instead of proteinphenix.autosol w1.sca seq.dat 2 Se lambda=0.9798 \ chain_type=RNAThis will carry out the usual structure solution, but will build an RNA chain. For DNA, specify chain_type=DNA. You can only build one type of chain at a time in the AutoSol Wizard. To build protein and DNA, use the AutoBuild Wizard and run it first with chain_type=PROTEIN, then run it again specifying the protein model as input_lig_file_list=proteinmodel.pdb and with chain_type=DNA. SAD dataset, selecting a particular dataset from an MTZ fileIf you have an input MTZ file with more than one anomalous dataset, you can type something like: phenix.autosol w1.mtz seq.dat 2 Se lambda=0.9798 \ labels='F+ SIGF+ F- SIGF-'This will carry out the usual structure solution, but will choose the input data columns based on the labels: 'F+ SIGF+ F- SIGF-' NOTE: to specify anomalous data with F+ SIGF+ F- SIGF- like this, these 4 columns must be adjacent to each other in the MTZ file with no other columns in between. FURTHER NOTE: to instead use a FAVG SIGFAVG DANO SIGDANO array in AutoSol, the data file or an input refinement file MUST also contain a separate array for FP SIGFP or I SIGI or equivalent. This is because FAVG DANO arrays are ONLY allowed as anomalous information, not as amplitudes or intensities. You can use F+ SIGF+ F- SIGF- arrays as a source of both anomalous differences and amplitudes if you want, however. If you run the AutoSol Wizard with SAD data and an MTZ file containing more than one anomalous dataset and don't tell it which one to use, all possible values of labels are printed out for you so that you can just paste the one you want in. You can also find out all the possible label strings to use by typing: phenix.autosol display_labels=w1.mtz # display all labels for w1.mtz MRSAD -- SAD dataset with an MR model; Phaser SAD phasing including the modelIf you are carrying out SAD phasing with Phaser, you can carry out a combination of molecular replacement phasing and SAD phasing (MRSAD) by adding a single new keyword to your AutoSol run: input_partpdb_file=MR.pdbIn this case the MR.pdb file will be used as a partial model in a maximum-likelihood SAD phasing calculation with Phaser to calculate phases and identify sites in Phaser, and the combined MR+SAD phases will be written out. NOTE: At the moment the AutoBuild Wizard is not equipped to use these combined phases optimally in iterative model-building, density modification and refinement, because they contain both experimental phase information and model information. It is therefore possible that the resulting phases are biased by your MR model, and that this bias will not go away during iterative model-building because it is continually fed back in. Using an MR model to find sites and as a source of phase information (method #2 for MRSAD)You can also combine MR information with SAD phases (see J. P. Schuermann and J. J. Tanner Acta Cryst. (2003). D59, 1731-1736 ) in PHENIX by running the three wizards AutoMR, AutoSol, and AutoBuild one after the other. This method does not use the partial model and the anomalous information in the SAD dataset simultaneously as the above Phaser maximum-likelihood method does. On the other hand, the phases obtained in this method are independent of the model, so that combining them afterwards does not introduce model bias. (It is not yet clear which is the better approach, so you may wish to try both.) Additionally, this approach can be used with any method for phasing. Here is a set of three simple commands to do this: First run AutoMR to find the molecular replacement solution, but don't rebuild it yet: phenix.automr gene-5.pdb peak.sca copies=1 \ RMS=1.5 mass=9800 rebuild_after_mr=FalseNow your MR solution is in AutoMR_run_1_/MR.1.pdb and phases are in AutoMR_run_1_/MR.1.mtz. Use these phases as input to AutoSol, along with some weak SAD data, still not building any new models: phenix.autosol data=peak.sca \ input_phase_file=AutoMR_run_1_/MR.1.mtz input_phase_labels="F PHIC FOM" \ seq_file=sequence.dat build=Falsenote that we have specified the data columns for F PHI and FOM in the input_phase_file. For input_phase_file you must specify all three of these (if you leave out FOM it will set it to zero). AutoSol will write an MTZ file with experimental phases to phaser_xx.mtz where xx depends on how many solutions are considered during the run. The next command for running AutoBuild you will need to edit depending on the value of xx: phenix.autobuild data=AutoSol_run_1_/phaser_2.mtz \ model=AutoMR_run_1_/MR.1.pdb seq_file=sequence.dat rebuild_in_place=FalseAutoBuild will now take the phases from your AutoSol run and combine them with model-based information from your AutoMR MR solution, and will carry out iterative density modification, model-building and refinement to rebuild your model. Note that you may wish to set rebuild_in_place=True, depending on how good your MR model is. SAD dataset, reading heavy-atom sites from a PDB file written by phenix.hyssphenix.autosol 11 Pb data=deriv.sca seq_file=seq.dat \ sites_file=deriv_hyss_consensus_model.pdb lambda=0.95This will carry out the usual structure solution process, but will read sites from deriv_hyss_consensus_model.pdb, try both hands, and carry on from there. If you know the hand of the substructure, you can fix it with have_hand=True. MAD datasetThe inputs for a MAD dataset need to specify f_prime and f_double_prime for each wavelength. You can use a parameters file "mad.eff" to input MAD data. You run it with "phenix.autosol mad.eff". Here is an example of a parameters file for a MAD dataset. You can set many additional parameters as well (see the list at the end of this document). autosol { seq_file = seq.dat sites = 2 atom_type = Se wavelength { data = peak.sca lambda = .9798 f_prime = -8.0 f_double_prime = 4.5 } wavelength { data = inf.sca lambda = .9792 f_prime = -9.0 f_double_prime = 1.5 } } MAD dataset, selecting particular datasets from an MTZ fileThis is similar to the case for running a SAD analysis, selecting particular columns of data from an MTZ file. If you have an input MTZ file with more than one anomalous dataset, you can use a parameters file like the one above for MAD data, but adding information on the labels in the MTZ file that are to be chosen for each wavelength: autosol { seq_file = seq.dat sites = 2 atom_type = Se wavelength { data = mad.mtz lambda = .9798 f_prime = -8.0 f_double_prime = 4.5 labels='peak(+) SIGpeak(+) peak(-) SIGpeak(-)' } wavelength { data = mad.mtz lambda = .9792 f_prime = -9.0 f_double_prime = 1.5 labels='infl(+) SIGinfl(+) infl(-) SIGinfl(-)' } }This will carry out the usual structure solution, but will choose the input peak data columns based on the label keywords. As in the SAD case, you can find out all the possible label strings to use by typing: phenix.autosol display_labels=w1.mtz # display all labels for w1.mtz SIR datasetThe standard inputs for an SIR dataset are the native and derivative, the sequence file, the heavy-atom type, and the number of sites, as well as whether to use anomalous differences (or just isomorphous differences): phenix.autosol native.data=native.sca deriv.data=deriv.sca \ atom_type=I sites=2 inano=inanoThis will set the heavy-atom type to Iodine, look for 2 sites, and include anomalous differences. You can also specify many more parameters using a parameters file. This parameters file shows some of them: autosol { seq_file = seq.dat native { data = native.sca } deriv { data = pt.sca lambda = 1.4 atom_type = Pt f_prime = -3.0 f_double_prime = 3.5 sites = 3 } } SAD with more than one anomalously-scattering atomYou can tell the AutoSol wizard to look for more than one anomalously- scattering atom. Specify one atom type (Se) in the usual way. Then specify any additional ones like this if you are running AutoSol from the command line: mad_ha_add_list="Br Pt"Optionally, you can add f_prime and f_double_prime values for the additional atom types with commands like mad_ha_add_f_prime_list=" -7 -10" mad_ha_add_f_double_prime_list=" 4.2 12"but the values from table lookup should be fine. Note that there must be the same number of entries in each of these three keyword lists, if given. During phasing Phaser will try to add whichever atom types best fit the scattering from each new site. This option is available for SAD phasing only and only for a single dataset (not with SAD+MIR etc). MIR datasetIt is easiest to run an MIR dataset using a parameters file such as "mir.eff" which you then run with "phenix.autosol mir.eff". Here is an example parameters file for MIR: autosol { seq_file = seq.dat native { data = native.sca } deriv { data = pt.sca lambda = 1.4 atom_type = Pt } deriv { data = ki.sca lambda = 1.5 atom_type = I } } You can enter as many derivatives as you want. If you specify a wavelength and heavy atom type then scattering factors are calculated from a table for that heavy-atom. You can instead enter scattering factors with the keywords "f_prime = -3.0 " "f_double_prime = 5.0" if you want. SIR + SAD datasetsA combination of SIR and SAD datasets (or of SAD+SAD or MIR+SAD+SAD or any other combination) is easy with a parameters file. You tell the wizard which grouping each wavelength, native, or derivative goes with with a keyword such as "group=1". autosol { seq_file = seq.dat native { group = 1 data = native.sca } deriv { group = 1 data = pt.sca lambda = 1.4 atom_type = Pt } wavelength { group = 2 data = w1.sca lambda = .9798 atom_type = Se f_prime = -7. f_double_prime = 4.5 } } The SIR and SAD datasets will be solved separately (but whichever one is solved first will use difference Fourier or anomalous difference Fourier's to locate sites for the other). Then phases will be combined by addition of Hendrickson-Lattman coefficients and the combined phases will be density modified. Possible ProblemsGeneral limitationsSpecific limitations and problems
Literature
Additional informationList of all AutoSol keywords------------------------------------------------------------------------------- Legend: black bold - scope names black - parameter names red - parameter values blue - parameter help blue bold - scope help Parameter values: * means selected parameter (where multiple choices are available) False is No True is Yes None means not provided, not predefined, or left up to the program "%3d" is a Python style formatting descriptor ------------------------------------------------------------------------------- autosol atom_type= None Anomalously-scattering atom type. This sets the atom_type in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. lambda= None Wavelength (A). This sets the wavelength value in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. f_prime= None F-prime value. This sets the f_prime value in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. f_double_prime= None F-double-prime value. This sets the f_double_prime value in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. wavelength_name= peak inf high low remote Optional name of wavelength for SAD data. This sets the name in all wavelengths. Normally it is used as a shortcut for SAD cases. sites= None Number of heavy-atom sites. This sets the number of sites in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. sites_file= None PDB or plain-text file with ha sites. This sets the sites in all derivatives and wavelengths. Normally it is used as a shortcut for SAD or SIR cases. seq_file= Auto Text file with 1-letter code of protein sequence. Separate chains with a blank line or line starting with > Normally you should include one copy of each unique chain. NOTE: if 1 copy of each unique chain is provided it is assumed that there are ncs_copies (could be 1) of each unique chain. If more than one copy of any chain is provided it is assumed that the asymmetric unit contains the number of copies of each chain that are given, multiplied by ncs_copies. So if the sequence file has two copies of the sequence for chain A and one of chain B, the cell contents are assumed to be ncs_copies*2 of chain A and ncs_copies of chain B. ADDITIONAL NOTES: 1. lines starting with > are ignored and separate chains 2. FASTA format is fine 3. If you enter a PDB file for rebuilding and it has the sequence you want, then the sequence file is not necessary. NOTE: You can also enter the name of a PDB file that contains SEQRES records, and the sequence from the SEQRES records will be read, written to seq_from_seqres_records.dat, and used as your input sequence. If you have a duplex DNA, enter each strand as a separate chain. quick= None Run everything quickly (Same as thoroughness=quick) data= None Shortcut for name of datafile (SAD data only. For SIR use "native.data=native.sca" and "deriv.data=deriv.sca". For MIR and MAD use a parameters file and specify data under "native" and " deriv" or for "wavelength") NOTE: For command_line input it is easiest if each wavelength of data is in a separate data file with obvious data columns. File types that are easy to read include Scalepack sca files , CNS hkl files, mtz files with just one wavelength of data, or just native or just derivative. In this case the Wizard can read your data without further information. If you have a datafile with many columns, you can use the "labels" keyword to specify which data columns to read. (It may be easier in some cases to use the GUI or to split it with phenix.reflection_file_converter first, however.) labels= None Shortcut for specification string for data labels (SAD data only). Only necessary if the wizard does not automatically choose the correct set of data from your file For SIR use "native.labels" and "deriv.labels". For MIR and MAD use a parameters file and specify labels under "native" and " deriv" NOTE: To find out what the appropriate strings are, type "phenix.autosol display_labels=your-datafile-here.mtz" derscale= None shortcut for derivative scale crystal_info unit_cell= None Enter cell parameter (a b c alpha beta gamma) space_group= None Space Group symbol (i.e., C2221 or C 2 2 21) solvent_fraction= None Solvent fraction in crystals (0 to 1). This is normally set automatically from the number of NCS copies and the sequence. chain_type= *Auto PROTEIN DNA RNA You can specify whether to build protein, DNA, or RNA chains. At present you can only build one of these in a single run. If you have both DNA and protein, build one first, then run AutoBuild again, supplying the prebuilt model in the "input_lig_file_list" and build the other. NOTE: default for this keyword is Auto, which means "carry out normal process to guess this keyword". The process is to look at the sequence file and/or input pdb file to see what the chain type is. If there are more than one type, the type with the larger number of residues is guessed. If you want to force the chain_type, then set it to PROTEIN RNA or DNA. resolution= 0 High-resolution limit. Used as resolution limit for density modification and as general default high-resolution limit. If resolution_build or refinement_resolution are set then they override this for model-building or refinement. If overall_resolution is set then data beyond that resolution is ignored completely. Zero means keep everything. change_sg= False You can change the space group. In AutoSol the Wizard will use ImportRawData and let you specify the sg and cell. In AutoMR the wizard will give you an entry form to specify them. NOTE: This only applies when reading in new datasets. It does nothing when changed after datasets are read in. residues= None Number of amino acid residues in the au (or equivalent) sequence= None Plain text containing 1-letter code of protein sequence Same as seq_file except the sequence is read directly, not from a file. If both are given, seq_file is ignored. input_files cif_def_file_list= None You can enter any number of CIF definition files. These are normally used to tell phenix.refine about the geometry of a ligand or unusual residue. You usually will use these in combination with "PDB file with metals/ligands" (keyword "input_lig_file_list" ) which allows you to attach the contents of any PDB file you like to your model just before it gets refined. You can use phenix.elbow to generate these if you do not have a CIF file and one is requested by phenix.refine group_labels_list= None For command-line and script running of AutoSol, you may wish to use keywords to specify which set of data columns to be used from an MTZ or other file type with multiple datasets. (From the GUI, it is easy because you are prompted with the column labels). You can do this by specifying a string that identifies which dataset to include. All allowed values of this identification string will be written out any time AutoSol is run on this dataset like this: NOTE: To specify a particular set of data you can specify one of the following (this example is for MAD data, specifying data for peak wavelength): ...: peak.labels='F SIGF DANO SIGDANO' peak.labels='F(+) SIGF(+) F(-) SIGF(-)' You can then use one of the above commands on the command-line to identify the dataset of interest. If you want to use a script instead, you can specify N files in your input_data_file_list, and then specify N values for group_labels_list like this: group_labels_list 'F,SIGF,DANO,SIGDANO' 'F(+),SIGF(+),F(-),SIGF(-)' This will take 'F,SIGF,DANO,SIGDANO' as the data for datafile 1 and 'F(+),SIGF(+),F(-),SIGF(-)' for datafile 2 You can identify one dataset from each input file in this way. If you want more than one, then please use phenix.reflection_file_converter to split your input file, or else use the GUI version of AutoSol in which you can select any subset of the data that you wish. input_file_list= None Normally not used. Use "data=" or "wavelength.data=" or "native.data=" or "deriv.data=" instead. input_phase_file= None MTZ data file with FC PHIC or equivalent to use for finding heavy-atom sites with difference Fourier methods. input_phase_labels= None Labels for FC and PHIC for data file with FC PHIC or equivalent to use for finding heavy-atom sites with difference Fourier methods. input_refinement_file= None Data file to use for refinement. The data in this file should not be corrected for anisotropy. It will be combined with experimental phase information for refinement. If you leave this blank, then the output of phasing will be used in refinement (see below). If no anisotropy correction is applied to the data you do not need to specify a datafile for refinement. If an anisotropy correction is applied to the data files, then you must enter a datafile for refinement if you want to refine your model. (See "remove_aniso" for specifying whether an anisotropy correction is applied. In most cases it is not.) If an anisotropy correction is applied and no refinement datafile is supplied, then no refinement will be carried out in the model-building step. You can choose any of your datafiles to be the refinement file, or a native that is not part of the datasets for structure solution. If there are more than one dataset you will be asked each time for a refinement file, but only the last one will be used. Any standard format is fine; normally only F and sigF will be used. Bijvoet pairs and duplicates will be averaged. If an mtz file is provided then a free R flag can be read in as well. If you do not provide a refinement file then the structure factors from the phasing step will be used in refinement. This is normally satisfactory for SAD data and MIR data. For MAD data you may wish to supply a refinement file because the structure factors from phasing are a combination of data from different wavelengths of data. It is better if you choose your best wavelength of data for refinement. input_refinement_labels= None Labels for input refinement file columns (FP SIGFP FreeR_flag) input_seq_file= Auto Normally not used. Use instead "seq_file" refine_eff_file_list= None You can enter any number of refinement parameter files. These are normally used to tell phenix.refine defaults to apply, as well as creating specialized definitions such as unusual amino acid residues and linkages. These parameters override the normal phenix.refine defaults. They themselves can be overridden by parameters set by the Wizard and by you, controlling the Wizard. NOTE: Any parameters set by AutoBuild directly (such as number_of_macro_cycles, high_resolution, etc...) will not be taken from this parameters file. This is useful only for adding extra parameters not normally set by AutoBuild. wavelength Enter a SAD or MAD dataset by filling in information for one or more wavelengths. You can cut and paste an entire wavelength section and enter as many as you like. If you have multiple datasets (i.e., MIR+MAD) then group them using the "group" keyword. wavelength_name= peak inf high low remote Optionally indicate if this is the peak, inflection point, high energy remote or low energy remote or remote data= None Datafile for this wavelength. labels= None Specification string for data labels for peak wavelength. Only necessary if the wizard does not automatically choose the correct set of data from your file To find out what the appropriate strings are, type "phenix.autosol display_labels=your-datafile-here.mtz" atom_type= None Anomalously-scattering atom type. You only need to specify this for one of the wavelengths in MAD datasets. NOTE: if you want Phaser to add additional heavy-atoms of other types, you can specify them with mad_ha_add_list. lambda= None wavelength (A). If you supply an atom_type and lambda then if you do not supply f_prime and f_double_prime a guess will be made for them from a table. res_hyss= None resolution for running HYSS for this wavelength/deriv res_eval= None resolution for evaluation of solutions for this wavelength/deriv f_prime= None F-prime value for this wavelength. It is best to supply it if you know it. f_double_prime= None F-double_prime value for this wavelength. It is best to supply it if you know it. sites= None Number of anomalously-scattering sites for this wavelength You only need to specify this for one wavelength. If you have only MAD data you can also just specify "sites=2" sites_file= None PDB or plain-text file with heavy-atom sites. The sites will be taken from this file if supplied derscale= None derivative scale factor group= 1 Phasing group(s) this wavelength is associated with (Relevant in cases where you have 2 MAD datasets or MAD+SAD or MAD+MIR etc...) added_wavelength= False Used internally to flag if this wavelength was added automatically ignore= False Ignore this wavelength of data native Enter an MIR or SIR dataset by filling in information for a native and one or more derivatives. You can cut and paste these sections and enter as many as you like. If you have multiple datasets (i.e., MIR+MAD) then group them using the "group" keyword. data= None Datafile for native labels= None Specification string for data labels for native. Only necessary if the wizard does not automatically choose the correct set of data from your file To find out what the appropriate strings are, type "phenix.autosol display_labels=your-datafile-here.mtz " lambda= None wavelength (A) (Not used, for your reference only). group= 1 Phasing group(s) this native is associated with (Relevant in cases where you have more than one group of native+derivs or you have MIR + MAD or SAD) added_native= False Used internally to flag if this native was added automatically ignore= False Ignore this native data deriv Enter an MIR or SIR dataset by filling in information for a native and one or more derivatives. You can cut and paste these sections and enter as many as you like. If you have multiple datasets (i.e., MIR+MAD) then group them using the "group" keyword. data= None Datafile for this derivative labels= None Specification string for data labels for deriv. Only necessary if the wizard does not automatically choose the correct set of data from your file To find out what the appropriate strings are, type "phenix.autosol display_labels=datafile.mtz " atom_type= None Heavy-atom type for deriv . sites= None Number of heavy-atom sites for deriv . sites_file= None PDB or plain-text file with heavy-atom sites. The sites will be taken from this file if supplied res_hyss= None resolution for running HYSS for this wavelength/deriv res_eval= None resolution for evaluation of solutions for this wavelength/deriv inano= noinano *inano anoonly Use anomalous differences for deriv . noinano means do not use anomalous differences. inano means use anomalous differences and isomorphous differences. anoonly means use anomalous differences and not iso differences. f_prime= None F-prime value for this derivative. f_double_prime= None F-double_prime value for this derivative. lambda= None wavelength (A). Used with atom_type to calculate f_prime and f_double_prime if they are not supplied derscale= None derivative scale factor group= 1 Phasing group(s) this derivative is associated with (Relevant in cases where you have more than one group of native+derivs or you have MIR + MAD or SAD) added_deriv= False Used internally to flag if this derivative was added automatically ignore= False Ignore this deriv data decision_making always_include_peak= True Choose True to add PEAK dataset on for HYSS if not automatically chosen add_extra_if_fa= True Choose True to try an extra file for HYSS if FA values are used. This may be useful to solve cases where FA values are poor but their sigmas are small. If True then the anomalous differences will be used for HYSS as well. create_scoring_table= None Choose whether you want a scoring table for solutions A scoring table is slower but better desired_coverage= None Choose what probability you want to have that the correct solution is in your current list of top solutions. A good value is 0.80. If you set a low value (0.01) then only one solution will be kept at any time; if you set a high value, then many solutions will be kept (and it will take longer). skip_hyss_other_derivs_if_quick= True You can skip HYSS and instead use difference Fouriers only to find sites for all other derivatives once a good HYSS solution is found. Only used if thoroughness=quick . self_diff_fourier= True Choose whether, in cases where there are multiple derivatives or multiple datasets, you want to use difference Fourier analysis on the same derivative(s) used in phasing (True), or instead (False) only phasing other derivatives combine_siblings= True You can specify that in MIR or multiple-dataset solutions the solutions to combine must all be ultimately derived by difference fourier from the same parent. Compare with combine_same_parent_only where any solutions must have the same immediate parent (unless one is a composite solution). max_cc_extra_unique_solutions= 0.5 Specify the maximum value of CC between experimental maps for two solutions to consider them substantially different. Solutions that are within the range for consideration based on desired_coverage, but are outside of the number of allowed max_choices, will be considered, up to max_extra_unique_solutions, if they have a correlation of no more than max_cc_extra_unique_solutions with all other solutions to be tested. max_choices= None Number of choices for solutions to consider. Set automatically with quick: 1 and thorough:3 max_composite_choices= 8 Number of choices for composite solutions to consider max_extra_unique_solutions= None Specify the maximum number of solutions to consider based on their uniqueness as well as their high scores. Solutions that are within the range for consideration based on desired_coverage, but are outside of the number of allowed max_choices, will be considered, up to max_extra_unique_solutions, if they have a correlation of no more than max_cc_extra_unique_solutions with all other solutions to be tested. Set automatically with quick:0 ; thorough:2 max_range_to_keep= 4 The range of solutions to be kept is range_to_keep * SD of the group of solutions. This sets the maximum of range_to_keep min_fom= 0.05 Minimum fom of a solution to keep it at all low_fom= 0.20 If best FOM is less than low_fom, double range_to_keep minimum_merge_cc= 0.25 Minimum ratio of CC of solutions to expected in merge_mir keep at all min_fom_for_dm= 0 Minimum fom of a solution to density modify (otherwise just copy over phases). This is useful in cases where the phasing is so weak that density modification does nothing or makes the phases worse. extreme_dm= False Turns on extreme density modification if FOM is up to fom_for_extreme_dm fom_for_extreme_dm= 0.35 If extreme_dm is true and FOM of phasing is up to fom_for_extreme_dm then defaults for density modification become: mask_type=wang wang_radius=20 mask_cycles=1 minor_cycles=4 minimum_ncs_cc= 0.30 Minimum NCS correlation to keep, except in case of extreme_dm min_phased_each_deriv= 1 You can require that the wizard phase at least this number of solutions from each derivative, even if they are poor solutions. Usually at least 1 is a good idea so that one derivative does not dominate the solutions. n_random= 6 Number of random solutions to generate when setting up scoring table res_eval= 0 Resolution for running resolve evaluation (usually 2.5 A) It will be set automatically if you do not set it score_individual_offset_list= None Offsets for individual scores in CC-scoring. Each score will be multiplied by the score_individual_scale_list value, then score_individual_offset_list value is added, to estimate the CC**2 value using this score by itself. The uncertainty in the CC**2 value is given by score_individual_sd_list. NOTE: These scores are not used in calculation of the overall score. They are for information only score_individual_scale_list= None Scale factors for individual scores in CC-scoring. Each score will be multiplied by the score_individual_scale_list value, then score_individual_offset_list value is added, to estimate the CC**2 value using this score by itself. The uncertainty in the CC**2 value is given by score_individual_sd_list. NOTE: These scores are not used in calculation of the overall score. They are for information only score_individual_sd_list= None Uncertainties for individual scores in CC-scoring. Each score will be multiplied by the score_individual_scale_list value, then score_individual_offset_list value is added, to estimate the CC**2 value using this score by itself. The uncertainty in the CC**2 value is given by score_individual_sd_list. NOTE: These scores are not used in calculation of the overall score. They are for information only score_overall_offset= None Overall offset for scores in CC-scoring. The weighted scores will be summed, then all multiplied by score_overall_scale, then score_overall_offset will be added. score_overall_scale= None Overall scale factor for scores in CC-scoring. The weighted scores will be summed, then all multiplied by score_overall_scale, then score_overall_offset will be added. score_overall_sd= None Overall SD of CC**2 estimate for scores in CC-scoring. The weighted scores will be summed, then all multiplied by score_overall_scale, then score_overall_offset will be added. This is an estimate of CC**2, with uncertainty about score_overall_sd. Then the square root is taken to estimate CC and SD(CC), where SD(CC) now depends on CC due to the square root. score_type_list= SKEW CORR_RMS You can choose what scoring methods to include in scoring of solutions in AutoSol. (The choices available are: CC_DENMOD RFACTOR SKEW NCS_COPIES NCS_IN_GROUP TRUNCATE FLATNESS CORR_RMS REGIONS CONTRAST FOM ) NOTE: If you are using Z-SCORE or BAYES-CC scoring, The default is CC_RMS RFACTOR SKEW FOM (and NCS_OVERLAP if ncs_copies is at least equal to ncs_copies_min_for_overlap. score_weight_list= None Weights on scores for CC-scoring. Enter the weight on each score in score_type_list. The weighted scores will be summed, then all multiplied by score_overall_scale, then score_overall_offset will be added. skip_score_list= None You can evaluate some scores but not use them. Include the ones you do not want to use in the final score in skip_score_list. ncs_copies_min_for_overlap= 2 Minimum number of ncs copies (set automatically from composition and cell or with ncs_copies=xx) to use NCS_OVERLAP in scoring rho_overlap_min= 0.3 Sets minimum average overlap of NCS-related density to keep NCS. Cutoff of overlap will be rho_overlap_min for 2 ncs copies, and proportionally smaller (rho_overlap_min*2/N) for N ncs copies. rho_overlap_min_scoring= 0.5 Once NCS is found, rho_overlap_min_scoring sets threshold for whether the NCS is used in scoring. Cutoff of overlap will be rho_overlap_min_scoring for 2 ncs copies, and proportionally smaller (rho_overlap_min_scoring*2/N) for N ncs copies. (Compare with rho_overlap_min, which sets cutoff for finding NCS, not scoring with it) hyss_scoring ha_iteration= None Choose whether you want to iterate the heavy-atom search. With iteration, sites are found with HYSS, then used to phase and carry out quick density-modification, then difference Fourier is used to find sites again and improve their accuracy. Default is to not use ha_iteration except in multi-dataset or MIR analyses max_ha_iterations= None Number of iterations of difference Fouriers in searching for heavy-atom sites. Default is to set this based on data_quality. Iteration is not used by default if quick is True. minimum_improvement= 0 Minimum improvement in score to continue ha iteration build_scoring overall_score_method= *BAYES-CC Z-SCORE You have 2 choices for an overall scoring method: (1) Sum of individual Z-scores (Z-SCORE) (2) Bayesian estimate of CC of map to perfect model (BAYES-CC) You can specify which scoring criteria to include with score_type_list (default is SKEW CORR_RMS for BAYES-CC and CC RFACTOR SKEW FOM for Z-SCORE. Additionally, if NCS is present, NCS_OVERLAP is used by default in the Z-SCORE method). r_switch= 0.4 R-value criteria for deciding whether to use R-value or residues built. A good value is 0.40 acceptable_quality= 40 You can specify the minimum overall quality of a model (as defined by overall_score_method) to be considered acceptable acceptable_secondary_structure_cc= 0.35 You can specify the minimum correlation of density from a secondary structure model to be considered acceptable trace_chain= False You can build a CA-only model right after density modification using trace_chain trace_chain_score= False You can score density-modified maps with the number of residues built with regular secondary-structure using trace_chain. dev_scoring random_scoring= False For testing purposes you can generate random scores use_perfect= False You can use the CC between each solution and hklperfect in scoring. This is only for methods development purposes. hklperfect= None You can supply an mtz file with idealized coefficients for a map. This will be compared with all maps calculated during structure solution perfect_labels= None Labels for input data columns for hklperfect if present. Typical value: "FP PHIC FOM" scaling remove_aniso= Auto *True False Choose if you want to apply a correction for anisotropy to the data. True means always apply correction, No means never apply it, Auto means apply it if the data is severely anisotropic (recommended=True). If you set remove_aniso=Auto then if the range of anisotropic B-factors is greater than delta_b_for_auto_remove_aniso and the ratio of the largest to the smallest less than ratio_b_for_auto_remove_aniso then the correction will be applied. Anisotropy correction will be applied to all input data before scaling. If used, the default overall target B factor is is minimum of (max_b_iso, lowest B of datasets, target_b_ratio*resolution) b_iso= None Target overall B value for anisotropy correction. Ignored if remove_aniso = False. If None, default is minimum of (max_b_iso, lowest B of datasets, target_b_ratio*resolution) max_b_iso= 40. Default maximum overall B value for anisotropy correction. Ignored if remove_aniso = False. Ignored if b_iso is set. If used, default is minimum of (max_b_iso, lowest B of datasets, target_b_ratio*resolution) target_b_ratio= 10. Default ratio of target B value to resolution for anisotropy correction. Ignored if remove_aniso = False. Ignored if b_iso is set. If used, default is minimum of (max_b_iso, lowest B of datasets, target_b_ratio*resolution) localscale_before_phaser= True You can apply SOLVE localscaling to SAD data before passing it to Phaser for SAD phasing delta_b_for_auto_remove_aniso= 20 Choose what range of aniso B values is so big that you want to correct for anisotropy by default. Both ratio_b and delta_b must be large to correct. See also ratio_b_for_auto_remove_aniso. See also "remove_aniso" which overrides this default if set to "True" ratio_b_for_auto_remove_aniso= 1.0 Choose what ratio aniso B values is so big that you want to correct for anisotropy by default. Both ratio_b and delta_b must be large to correct. see also delta_b_for_auto_remove_aniso See also "remove_aniso" which overrides this default if set to "True" test_remove_aniso= True Choose whether you want to try applying or not applying an anisotropy correction if the run fails. First your original selection for applying or not will be tried, and then the opposite will be tried if the run fails. use_sca_as_is= True Choose True to allow use of sca files (and mtz files) without conversion even if the space group is changed. If False, then original index files will always be converted to premerged if the space group is changed derscale_list= None List of deriv scale factors. Not normally used. Use derscale for deriv or wavelength. heavy_atom_search min_hyss_cc= 0.05 Minimum CC of a heavy-atom solution in HYSS to keep it at all acceptable_cc_hyss= 0.2 Solutions with CC better than acceptable_cc_hyss will not be rescored. good_cc_hyss= 0.3 Hyss will be run up to best_of_n_hyss_always times at a given resolution. If the best CC value is greater than good_cc_hyss and the number of sites found is at least min_fraction_of_sites_found times the number expected and Hyss was tried at least best_of_n_hyss times, then the search is ended. Also if thoroughness=quick and a solution with CC at least as high as good_cc_hyss is found, no more searches will be done at all n_add_res_max= 2 Hyss will be run at up to n_add_res_max+1 resolutions starting with res_hyss and adding increments of add_res_max/n_add_res_max. If the best CC value is greater than good_cc_hyss then no more resolutions are tried. add_res_max= 2 Hyss will be run at up to n_add_res_max+1 resolutions starting with res_hyss and adding increments of add_res_max/n_add_res_max. If the best CC value is greater than good_cc_hyss then no more resolutions are tried. try_recommended_resolution_for_hyss= True If yes, then hyss will be run at recommended_resolution based on anomalous signal in addition to default resolution if CC at default resolution is less than good_cc_hyss and recommended_resolution is more than 0.1 A less than default hyss_runs_min= 2 If there are multiple derivatives or candidate wavelengths for HYSS, run at least hyss_runs_min of these. best_of_n_hyss= 1 Hyss will be run up to best_of_n_hyss_always times at a given resolution. If the best CC value is greater than good_cc_hyss and the number of sites found is at least min_fraction_of_sites_found times the number expected and Hyss was tried at least best_of_n_hyss times, then the search is ended if hyss_runs_min data files have been attempted. best_of_n_hyss_always= 10 Hyss will be run up to best_of_n_hyss_always times at a given resolution. If the best CC value is greater than good_cc_hyss and the number of sites found is at least min_fraction_of_sites_found times the number expected and Hyss was tried at least best_of_n_hyss times, then the search is ended if hyss_runs_min data files have been attempted. min_fraction_of_sites_found= 0.667 Hyss will be run up to best_of_n_hyss_always times at a given resolution. If the best CC value is greater than good_cc_hyss and the number of sites found is at least min_fraction_of_sites_found times the number expected and Hyss was tried at least best_of_n_hyss times, then the search is ended if hyss_runs_min data files have been attempted. max_single_sites= 5 In sites_from_denmod a core set of sites that are strong is identified. If the hand of the solution is known then additional sites are added all at once up to the expected number of sites. Otherwise sites are added one at a time, up to a maximum number of tries of max_single_sites hyss_enable_early_termination= True You can specify whether to stop HYSS as soon as it finds a convincing solution (True, default) or to keep trying... hyss_general_positions_only= True Select True if you want HYSS only to consider general positions and ignore sites on special positions. This is appropriate for SeMet or S-Met solutions, not so appropriate for heavy-atom soaks hyss_min_distance= 3.5 Enter the minimum distance between heavy-atom sites to keep them in HYSS hyss_n_fragments= 3 Enter the number of fragments in HYSS hyss_n_patterson_vectors= 33 Enter the number of Patterson vectors to consider in HYSS hyss_random_seed= 792341 Enter an integer as random seed for HYSS res_hyss= None Overall resolution for running HYSS (usually default is fine) use_measurability= True Use measurability (from xtriage) to estimate recommended resolution for HYSS and for initial phasing. Only applies to MAD/SAD phasing. Alternative is to use signal-to-noise from Solve scaling. use_phaser_rescoring= False Run phaser rescoring for HYSS heavy-atom search (only SAD data) if initial try fails mad_ha_n= None Normally not used. Use instead "sites" for a wavelength. Number of anomalously-scattering atoms in the au mad_ha_type= "Se" Normally not used. Use instead "atom_type" for a wavelength. Anomalously-scattering or heavy atom type. For" example, Se or Au. NOTE: if you want Phaser to add additional heavy-atoms of other types, you can specify them with mad_ha_add_list. phasing do_madbst= True Choose whether you want to carry out FA calculation Skipping it speeds up MAD phasing but may reduce the ability to find the sites with HYSS overallscale= False You can choose to have only an overall scale factor for this dataset (no local scaling applied). Use this if your data is already fully scaled. res_phase= 0 Enter the high-resolution limit for phasing (0= use all) phase_full_resolution= True You can choose to use the full resolution of the data in phasing, instead of using the recommended_resolution. This is always a good idea with Phaser phases. fixscattfactors= None For SOLVE phasing and MAD data you can choose whether scattering factors are to be fixed by choosing True to fix them or False to refine them. Normally choose True (fix) if the data are weak and False (refine) if the data are strong. fixscattfactors_in_phasing= False Fix scattering factors in phasing step. For SOLVE phasing and MAD data you can choose whether scattering factors are to be fixed by choosing True to fix them or False to refine them. Normally False. This command only applies to the phasing step and not initial heavy-atom refinement. It does not apply to Phaser SAD phasing. fix_xyz_in_phasing= None Fix coordinates in phasing step. For SOLVE phasing and MAD data you can choose whether ha coordinates are to be fixed by choosing True to fix them or False to refine them. May be useful in maintaining the coordinates of the solutions that were tested in initial phasing steps. If None, then it will be set to True if the resolution of final phasing step is higher than the highest resolution of test phasing runs This command only applies to the phasing step and not initial heavy-atom refinement. It does not apply to Phaser SAD phasing have_hand= False Normally you will not know the hand of the heavy-atom substructure, so have_hand=False. However if you do know it (you got the sites from a difference Fourier or you know the answer another way) you can specify that the hand is known. id_scale_ref= None By default the datafile with the highest resolution is used for the first step in scaling of MAD data. You can choose to use any of the datafiles in your MAD dataset. NOTE: not applicable for multi-dataset analyses ratio_out= 10. You can choose the ratio of del ano or del iso to the rms in the shell for rejection of a reflection. Default = 10. ratmin= 0. Reflections with I/sigI less than ratmin will be ignored when read in. require_nat= True Choose yes to skip any reflection with no native (for SIR) or no data (MAD/SAD) or where anom difference is very large. This keyword (default=True) allows the routines in SOLVE to remove reflections with an implausibly large anomalous difference (greater than ratio_out times the rms anomalous difference). ikeepflag= 1 You can choose to keep all reflections in merging steps. This is separate from rejecting reflections with high iso or ano diffs. Default=1 (keep them) phasing_method= SOLVE *PHASER You can choose to phase with SOLVE or with Phaser. (Only applies to SAD phasing at present) input_partpdb_file= None You can enter a PDB file (usually from molecular replacement) for use in identifying heavy-atom sites and phasing. NOTE 1: This procedure works best if the model is refined. NOTE 2: This file is only used in SAD phasing with Phaser on a single dataset. In all other cases it is ignored. NOTE 3: The output phases in phaser_xx.mtz will contain both SAD and model information. They are not completely suitable for use with AutoBuild or other iterative model-building procedures because the phases are not entirely experimental (but they may work). partpdb_rms= 1 llgc_sigma= None phaser_completion= True You can choose to use phaser log-likelihood gradients to complete your heavy-atom sites. This can be used with or without the ha_iteration option. use_phaser_hklstart= True You can choose to start density modification with FWT PHWT from Phaser (Only applies to SAD phasing at present) combine_same_parent_only= False You can choose to only combine solutions with the same parent (and that have a parent) in MIR, unless one solution is a composite. Compare with combine_siblings in which case the solutions do not have to have the same immediate parents, but can be derived from the same ultimate parent through several difference fourier steps. skip_extra_phasing= *Auto True False You can choose to skip an extra phasing step to speed up the process. If the extra step is used then the evaluation of solutions is done with data to res_eval (2.5 A) and then all the data are used in an extra phasing step. Only applicable to Phaser SAD phasing. read_sites= False Choose if you want to enter ha sites from a file The name of the file will be requested after scaling is finished. The file can have sites in fractional coordinates or be a PDB file. Normally you do not need to set this. Set automatically if you specify a sites_file f_double_prime_list= None f-double-prime for the heavy-atom for this dataset Normally not used. Use f_double_prime for wavelength or deriv f_prime_list= None f-prime for the heavy-atom for this dataset Normally not used. Use f_prime for wavelength or deriv mad_ha_add_f_double_prime_list= None F-double_prime values of additional heavy-atom types. You must specify the same number of entries of mad_ha_add_f_double_prime_list as you do for mad_ha_add_f_prime_list and for mad_ha_add_list. Only use for Phaser SAD phasing with a single dataset mad_ha_add_f_prime_list= None F-prime values of additional heavy-atom types. You must specify the same number of entries of mad_ha_add_f_prime_list as you do for mad_ha_add_f_double_prime_list and for mad_ha_add_list. Only use for Phaser SAD phasing with a single dataset mad_ha_add_list= None You can specify heavy atom types in addition to the one you named in mad_ha_type. The heavy-atoms found in initial HySS searches will be given the type of mad_ha_type, and Phaser (if used for phasing) will try to find additional heavy atoms of both the type mad_ha_type and any listed in mad_ha_add_list. You must also specify the same number of mad_ha_add_f_prime_list entries and of mad_ha_add_f_double_prime_list entries. Only use for Phaser SAD phasing with a single dataset n_ha_list= None Enter a guess of number of HA sites Normally not used. Use sites in deriv instead nat_der_list= None Enter Native or a heavy-atom symbol (Pt, Se) Normally not used. Use atom_type in deriv instead density_modification fix_xyz= False You can choose to not refine coordinates, and instead to fix them to the values found by the heavy-atom search. fix_xyz_after_denmod= None When sites are found after density modification you can choose whether you want to fix the coordinates to the values found in that map. hl_in_resolve= False AutoSol normally does not write out HL coefficients in the resolve.mtz file with density-modified phases. You can turn them on with hl_in_resolve=True mask_type= *histograms probability wang classic Choose method for obtaining probability that a point is in the protein vs solvent region. Default is "histograms". If you have a SAD dataset with a heavy atom such as Pt or Au then you may wish to choose "wang" because the histogram method is sensitive to very high peaks. Options are: histograms: compare local rms of map and local skew of map to values from a model map and estimate probabilities. This one is usually the best. probability: compare local rms of map to distribution for all points in this map and estimate probabilities. In a few cases this one is much better than histograms. wang: take points with highest local rms and define as protein. Classic runs classical density modification with solvent flipping. test_mask_type= None You can choose to have AutoSol test histograms/wang methods for identifying solvent region and statistical vs classical density modification based on the final density modification r-factor. mask_cycles= 5 Number of mask cycles in density modification (5 is usual for thorough density modification minor_cycles= 10 Number of minor cycles in density modification for each mask cycle (10 is usual for thorough density modification) thorough_denmod= None Choose whether you want to go for density modification (usual) or quick (speeds it up and for a terrible map is sometimes better) truncate_ha_sites_in_resolve= Auto *True False You can choose to truncate the density near heavy-atom sites at a maximum of 2.5 sigma. This is useful in cases where the heavy-atom sites are very strong, and rarely hurts in cases where they are not. The heavy-atom sites are specified with "input_ha_file" and radius is rad_mask rad_mask= None You can define the radius for calculation of the protein mask Applies only to truncate_ha_sites_in_resolve. Default is resolution of data. use_ncs_in_denmod= True This script normally uses available ncs information in density modification. Say No to skip this. See also find_ncs mask_as_mtz= False Defines how omit_output_mask_file ncs_output_mask_file and protein_output_mask_file are written out. If mask_as_mtz=False it will be a ccp4 map. If mask_as_mtz=True it will be an mtz file with map coefficients FP PHIM FOMM (all three required) protein_output_mask_file= None Name of map to be written out representing your protein (non-solvent) region. If mask_as_mtz=False the map will be a ccp4 map. If mask_as_mtz=True it will be an mtz file with map coefficients FP PHIM FOMM (all three required) ncs_output_mask_file= None Name of map to be written out representing your ncs asymmetric unit. If mask_as_mtz=False the map will be a ccp4 map. If mask_as_mtz=True it will be an mtz file with map coefficients FP PHIM FOMM (all three required) omit_output_mask_file= None Name of map to be written out representing your omit region. If mask_as_mtz=False the map will be a ccp4 map. If mask_as_mtz=True it will be an mtz file with map coefficients FP PHIM FOMM (all three required) use_hl_anom_in_denmod= None Default is False (use HL coefficients in density modification) Allows you to specify that HL coefficients including only the phase information from the imaginary (anomalous difference) contribution from the anomalous scatterers are to be used in density modification. Two sets of HL coefficients are produced by Phaser. HLA HLB etc are HL coefficients including the contribution of both the real scattering and the anomalous differences. HLanomA HLanomB etc are HL coefficients including the contribution of the anomalous differences alone. These HL coefficients for anomalous differences alone are the ones that you will want to use in cases where you are bringing in model information that includes the real scattering from the model used in Phaser, such as when you are carrying out density modification with a model or refinement of a model If use_hl_anom_in_denmod=True then the HLanom HL coefficients from Phaser are used in density modification use_hl_anom_in_denmod_with_model= None Default is True if input_partpdb_file is included. (See also use_hl_anom_in_denmod) If use_hl_anom_in_denmod=True then the HLanom HL coefficients from Phaser are used in density modification with a model precondition= False Precondition density before modification model_building build= True Build model after density modification? phase_improve_and_build= True Carry out cycles of phase improvement with quick model-building followed by a full model-building step NOTE: This is now the standard model-building approach for AutoSol sort_hetatms= False Waters are automatically named with the chain of the closest macromolecule if you set sort_hetatms=True This is for the final model only. map_to_object= None you can supply a target position for your model with map_to_object=my_target.pdb. Then at the very end your molecule will be placed as close to this as possible. The center of mass of the autobuild model will be superimposed on the center of mass of my_target.pdb using space group symmetry, taking any match closer than 15 A within 3 unit cells of the original position. The new file will be overall_best_mapped.pdb build_type= *RESOLVE RESOLVE_AND_BUCCANEER You can choose to build models with RESOLVE or with RESOLVE and BUCCANEER #and TEXTAL and how many different models to build with RESOLVE. The more you build, the more likely to get a complete model. Note that rebuild_in_place can only be carried out with RESOLVE model-building. For BUCCANEER model building you need CCP4 version 6.1.2 or higher and BUCCANEER version 1.3.0 or higher resolve Parameters specific for RESOLVE model-building n_cycle_build= None Choose number of cycles (3). refine= True This script normally refines the model during building. Say False to skip refinement ncycle_refine= 3 Choose number of refinement cycles (3) number_of_builds= None Number of different solutions to build models for number_of_models= None This parameter lets you choose how many initial models to build with RESOLVE within a single build cycle. resolution_build= 0 Enter the high-resolution limit for model-building. If 0.0, the value of resolution is used as a default. helices_strands_only= False You can choose to use a quick model-building method that only builds secondary structure. At low resolution this may be both quicker and more accurate than trying to build the entire structure If you are running the AutoSol Wizard, normally you should choose 'False' as standard building is quick. When your structure is solved by AutoSol, go on to AutoBuild and build a more complete model (still using helices_strands_only=False). NOTE: helices_strands_only does not apply in AutoSol if phase_improve_and_build=True helices_strands_start= False You can choose to use a quick model-building method that builds secondary structure as a way to get started...then model completion is done as usual. (Contrast with helices_strands_only which only does secondary structure) cc_helix_min= None Minimum CC of helical density to map at low resolution when using helices_strands_only cc_strand_min= None Minimum CC of strand density to map when using helices_strands_only loop_lib= False Use loop library to fit loops Only applicable for chain_type=PROTEIN standard_loops= True Use standard loop fitting trace_loops= False Use loop tracing to fit loops Only applicable for chain_type=PROTEIN refine_trace_loops= True Refine loops (real-space) after trace_loops density_of_points= None Packing density of points to consider as as possible CA atoms in trace_loops. Try 1.0 for a quick run, up to 5 for much more thorough run If None, try value depending on value of quick. max_density_of_points= None Maximum packing density of points to consider as as possible CA atoms in trace_loops. cutout_model_radius= None Radius to cut out density for trace_loops If None, guess based on length of loop max_cutout_model_radius= 20. Maximum value of cutout_model_radius to try padding= 1. Padding for cut out density in trace_loops max_span= 30 Maximum length of a gap to try to fill max_overlap= None Maximum number of residues from ends to start with. (1=use existing ends, 2=one in from ends etc) If None, set based on value of quick. min_overlap= None Minimum number of residues from ends to start with. (1=use existing ends, 2=one in from ends etc) fit_loops= True You can fit loops automatically if sequence alignment has been done. loop_cc_min= 0.4 You can specify the minimum correlation of density from a loop with the map. group_ca_length= 4 In resolve building you can specify how short a fragment to keep. Normally 4 or 5 residues should be the minimum. group_length= 2 In resolve building you can specify how many fragments must be joined to make a connected group that is kept. Normally 2 fragments should be the minimum. input_compare_file= None If you are rebuilding a model or already think you know what the model should be, you can include a comparison file in rebuilding. The model is not used for anything except to write out information on coordinate differences in the output log files. NOTE: this feature does not always work correctly. n_random_frag= 0 In resolve building you can randomize each fragment slightly so as to generate more possibilities for tracing based on extending it. n_random_loop= 3 Number of randomized tries from each end for building loops If 0, then one try. If N, then N additional tries with randomization based on rms_random_loop. offsets_list= 53 7 23 You can specify an offset for the orientation of the helix and strand templates in building. This is used in generating different starting models. remove_outlier_segments_z_cut= 3.0 You can remove any segments that are not assigned to sequence during model-building if the mean density at atomic positions are more than remove_outlier_segments_z_cut sd lower than the mean for the structure. resolve_command_list= None Commands for resolve. One per line in the form: keyword value value can be optional Examples: coarse_grid resolution 200 2.0 hklin test.mtz NOTE: for command-line usage you need to enclose the whole set of commands in double quotes (") and each individual command in single quotes (') like this: resolve_command_list="'no_build' 'b_overall 23' " solve_command_list= None Commands for solve. One per line in the form: keyword value, where value can be optional Examples: verbose resolution 200 2.0 For specification from command_line enclose each command and value in quotes, and then use a different type of quotes to enclose all of them (same as resolve_command_list) rms_random_frag= None Rms random position change added to residues on ends of fragments when extending them If you enter a negative number, defaults will be used. rms_random_loop= None Rms random position change added to residues on ends of loops in tries for building loops If you enter a negative number, defaults will be used. semet= None You can specify that the dataset that is used for refinement is a selenomethionine dataset, and that the model should be the SeMet version of the protein, with all SD of MET replaced with Se of MSE. By default if your heavy-atom is Se then this will be set to True use_met_in_align= Auto *True False You can use the heavy-atom positions in input_ha_file as markers for Met SD positions. start_chains_list= None You can specify the starting residue number for each of the unique chains in your structure. If you use a sequence file then the unique chains are extracted and the order must match the order of your starting residue numbers. For example, if your sequence file has chains A and B (identical) and chains C and D (identical to each other, but different than A and B) then you can enter 2 numbers, the starting residues for chains A and C. NOTE: you need to specify an input sequence file for start_chains_list to be applied. thorough_loop_fit= None Try many conformations and accept them even if the fit is not perfect. If you say True the parameters for thorough loop fitting are: n_random_loop=100 rms_random_loop=0.3 rho_min_main=0.5 while if you say No those for quick loop fitting are: n_random_loop=20 rms_random_loop=0.3 rho_min_main=1.0 trace_as_lig= False You can specify that in building steps the ends of chains are to be extended using the LigandFit algorithm. This is default for nucleic acid model-building. use_any_side= False You can choose to have resolve model-building place the best-fitting side chain at each position, even if the sequence is not matched to the map. ncs find_ncs= Auto *True False The wizard normally deduces ncs information from the NCS in heavy atom sites, and then later from any NCS in chains of models that are built during model-building. The update is done each cycle in which an improved model is obtained. Say No to skip this update. ncs_copies= None Number of copies of the molecule in the au (note: only one type of molecule allowed at present) ncs_refine_coord_sigma_from_rmsd= False You can choose to use the current NCS rmsd as the value of the sigma for NCS restraints. See also ncs_refine_coord_sigma_from_rmsd_ratio ncs_refine_coord_sigma_from_rmsd_ratio= 1 You can choose to multiply the current NCS rmsd by this value before using it as the sigma for NCS restraints See also ncs_refine_coord_sigma_from_rmsd optimize_ncs= True This script normally deduces ncs information from the NCS in chains of models that are built during iterative model-building. Optimize NCS adds a step to try and make the molecule formed by NCS as compact as possible, without losing any point-group symmetry. refine_with_ncs= True This script can allow phenix.refine to automatically identify NCS and use it in refinement. ncs_in_refinement= *torsion cartesian None Use torsion_angle refinement of NCS. Alternative is cartesian or None (None will use phenix.refine default) refinement refine_b= True You can choose whether phenix.refine is to refine individual atomic displacement parameters (B values) refine_se_occ= True You can choose to refine the occupancy of SE atoms in a SEMET structure (default=True). This only applies if semet=true skip_clash_guard= True Skip refinement check for atoms that clash correct_special_position_tolerance= None Adjust tolerance for special position check. If 0., then check for clashes near special positions is not carried out. This sometimes allows phenix.refine to continue even if an atom is near a special position. If 1., then checks within 1 A of special positions. If None, then uses phenix.refine default. (1) use_mlhl= True This script normally uses information from the input file (HLA HLB HLC HLD) in refinement. Say No to only refine on Fobs generate_hl_if_missing= False This script normally uses information from the input file (HLA HLB HLC HLD) in refinement. Say No to not generate HL coeffs from input phases. place_waters= True You can choose whether phenix.refine automatically places ordered solvent (waters) during the refinement process. refinement_resolution= 0 Enter the high-resolution limit for refinement only. This high-resolution limit can be different than the high-resolution limit for other steps. The default ("None" or 0.0) is to use the overall high-resolution limit for this run (as set by resolution) ordered_solvent_low_resolution= None You can choose what resolution cutoff to use fo placing ordered solvent in phenix.refine. If the resolution of refinement is greater than this cutoff, then no ordered solvent will be placed, even if refinement.main.ordered_solvent=True. link_distance_cutoff= 3 You can specify the maximum bond distance for linking residues in phenix.refine called from the wizards. r_free_flags_fraction= 0.1 Maximum fraction of reflections in the free R set. You can choose the maximum fraction of reflections in the free R set and the maximum number of reflections in the free R set. The number of reflections in the free R set will be up the lower of the values defined by these two parameters. r_free_flags_max_free= 2000 Maximum number of reflections in the free R set. You can choose the maximum fraction of reflections in the free R set and the maximum number of reflections in the free R set. The number of reflections in the free R set will be up the lower of the values defined by these two parameters. r_free_flags_use_lattice_symmetry= True When generating r_free_flags you can decide whether to include lattice symmetry (good in general, necessary if there is twinning). r_free_flags_lattice_symmetry_max_delta= 5 You can set the maximum deviation of distances in the lattice that are to be considered the same for purposes of generating a lattice-symmetry-unique set of free R flags. allow_overlapping= None Default is None (set automatically, normally False unless S or Se atoms are the anomalously-scattering atoms). You can allow atoms in your ligand files to overlap atoms in your protein/nucleic acid model. This overrides 'keep_pdb_atoms' Useful in early stages of model-building and refinement The ligand atoms get the altloc indicator 'L' NOTE: The ligand occupancy will be refined by default if you set allow_overlapping=True (because of the altloc indicator) You can turn this off with fix_ligand_occupancy=True fix_ligand_occupancy= None If allow_overlapping=True then ligand occupancies are refined as a group. You can turn this off with fix_ligand_occupancy=true NOTE: has no effect if allow_overlapping=False remove_outlier_segments= True You can remove any segments that are not assigned to sequence if their mean B values are more than remove_outlier_segments_z_cut sd higher than the mean for the structure. NOTE: this is done after refinement, so the R/Rfree are no longer applicable; the remarks in the PDB file are removed twin_law= None You can specify a twin law for refinement like this: twin_law='-h,k,-l' use_hl_anom_in_refinement= None Default is True if input_partpdb_file is used (See also use_hl_anom_in_denmod). If use_hl_anom_in_refinement=True then the HLanom HL coefficients from Phaser are used in refinement include_ha_in_refinement= None You can choose to include your heavy-atom sites in the model for refinement. This is a good idea if your structure includes these heavy-atom sites (i.e., for SAD or MAD structures where you are not using a native dataset). Heavy-atom sites that overlap an atom in your model will be ignored. Default is True unless the dataset is SAD/MAD with Se or S display number_of_solutions_to_display= 1 Number of solutions to put on screen and to write out solution_to_display= 0 Solution number of the solution to display and write out ( use 0 to let the wizard display the top solution) general data_quality= *moderate strong weak The defaults are set for you depending on the anticipated data quality. You can choose "moderate" if you are unsure. thoroughness= *quick thorough You can try to run quickly and see if you can get a solution ("quick") or more thoroughly to get the best possible solution ("thorough"). nproc= 1 You can specify the number of processors to use (nproc) and the number of batches to divide the data into for parallel jobs. Normally you will set nproc to the number of processors available and leave nbatch alone. If you leave nbatch as None it will be set automatically, with a value depending on the Wizard. This is recommended. The value of nbatch can affect the results that you get, as the jobs are not split into exact replicates, but are rather run with different random numbers. If you want to get the same results, keep the same value of nbatch. nbatch= 1 You can specify the number of processors to use (nproc) and the number of batches to divide the data into for parallel jobs. Normally you will set nproc to the number of processors available and leave nbatch alone. If you leave nbatch as None it will be set automatically, with a value depending on the Wizard. This is recommended. The value of nbatch can affect the results that you get, as the jobs are not split into exact replicates, but are rather run with different random numbers. If you want to get the same results, keep the same value of nbatch. keep_files= overall_best* phaser_*.mtz resolve_*.mtz solve_*.mtz ha_*.pdb List of files that are not to be cleaned up. wildcards permitted coot_name= "coot" If your version of coot is called something else, then you can specify that here. i_ran_seed= 72432 Random seed (positive integer) for model-building and simulated annealing refinement raise_sorry= False You can have any failure end with a Sorry instead of simply printout to the screen background= True When you specify nproc=nn, you can run the jobs in background (default if nproc is greater than 1) or foreground (default if nproc=1). If you set run_command=qsub (or otherwise submit to a batch queue), then you should set background=False, so that the batch queue can keep track of your runs. There is no need to use background=True in this case because all the runs go as controlled by your batch system. If you use run_command='sh ' (or similar, sh is default) then normally you will use background=True so that all the jobs run simultaneously. check_wait_time= 1.0 You can specify the length of time (seconds) to wait between checking for subprocesses to end max_wait_time= 1.0 You can specify the length of time (seconds) to wait when looking for a file. If you have a cluster where jobs do not start right away you may need a longer time to wait. The symptom of too short a wait time is 'File not found' wait_between_submit_time= 1.0 You can specify the length of time (seconds) to wait between each job that is submitted when running sub-processes. This can be helpful on NFS-mounted systems when running with multiple processors to avoid file conflicts. The symptom of too short a wait_between_submit_time is File exists:.... cache_resolve_libs= True Use caching of resolve libraries to speed up resolve resolve_size= 12 Size for solve/resolve ("","_giant", "_huge","_extra_huge" or a number where 12=giant 18=huge check_run_command= False You can have the wizard check your run command at startup run_command= "sh " When you specify nproc=nn, you can run the subprocesses as jobs in background with sh (default) or submit them to a queue with the command of your choice (i.e., qsub ). If you have a multi-processor machine, use sh. If you have a cluster, use qsub or the equivalent command for your system. NOTE: If you set run_command=qsub (or otherwise submit to a batch queue), then you should set background=False, so that the batch queue can keep track of your runs. There is no need to use background=True in this case because all the runs go as controlled by your batch system. If nproc is greater than 1 and you use run_command='sh '(or similar, sh is default) then normally you will use background=True so that all the jobs run simultaneously. queue_commands= None You can add any commands that need to be run for your queueing system. These are written before any other commands in the file that is submitted to your queueing system. For example on a PBS system you might say: queue_commands='#PBS -N mr_rosetta' queue_commands='#PBS -j oe' queue_commands='#PBS -l walltime=03:00:00' queue_commands='#PBS -l nodes=1:ppn=1' NOTE: you can put in the characters ' |