cctbxbb
Threads by month
- ----- 2025 -----
- July
- June
- May
- April
- March
- February
- January
- ----- 2024 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2023 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2022 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2021 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2020 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2019 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2018 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2017 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2016 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2015 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2014 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2013 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2012 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2011 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2010 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2009 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2008 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2007 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2006 -----
- December
- November
- October
- September
- August
- July
- June
- May
- April
- March
- February
- January
- ----- 2005 -----
- December
- November
- October
- September
- 584 discussions
Hi Folks
Spent this afternoon looking at
https://github.com/cctbx/cctbx_project/issues/532
which involves touching C++ header code deep in scitbx - which is fine - but every recompile generates hundreds of warnings from all over the place so your actual compiler errors are completely obscured
Massive amounts of deprecation errors everywhere e.g.
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/maptbx/asymmetric_map.cpp:5:
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/maptbx/asymmetric_map.h:18:
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/asymmetric_unit.h:6:
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/direct_space_asu.h:9:
/Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/facet_collection.h:72:34: warning: 'pointer' is deprecated [-Wdeprecated-declarations]
faces_ = facet_collection::pointer(a.faces_->new_copy());
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/asymmetric_unit.h:6:
In file included from /Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/direct_space_asu.h:9:
/Users/graeme/svn/cctbx/modules/cctbx_project/cctbx/sgtbx/direct_space_asu/proto/facet_collection.h:78:33: warning: 'pointer' is deprecated [-Wdeprecated-declarations]
faces(const facet_collection::pointer &a) : faces_(a->new_copy()) {}
^
/Users/graeme/svn/cctbx/conda_base/bin/../include/c++/v1/memory:2130:28: note: 'auto_ptr<cctbx::sgtbx::asu::facet_collection>' has been explicitly marked deprecated here
class _LIBCPP_TEMPLATE_VIS _LIBCPP_DEPRECATED_IN_CXX11 auto_ptr
^
/Users/graeme/svn/cctbx/conda_base/bin/../include/c++/v1/__config:972:39: note: expanded from macro '_LIBCPP_DEPRECATED_IN_CXX11'
# define _LIBCPP_DEPRECATED_IN_CXX11 _LIBCPP_DEPRECATED
^
/Users/graeme/svn/cctbx/conda_base/bin/../include/c++/v1/__config:961:48: note: expanded from macro '_LIBCPP_DEPRECATED'
# define _LIBCPP_DEPRECATED __attribute__ ((deprecated))
is there any appetite on the list to reduce the number of compiler warnings to make development easier?
Thanks Graeme
--
This e-mail and any attachments may contain confidential, copyright and or privileged material, and are for the use of the intended addressee only. If you are not the intended addressee or an authorised recipient of the addressee please notify us of receipt by returning the e-mail and do not use, copy, retain, distribute or disclose the information in or attached to the e-mail.
Any opinions expressed within this e-mail are those of the individual and not necessarily of Diamond Light Source Ltd.
Diamond Light Source Ltd. cannot guarantee that this e-mail or any attachments are free from viruses and we cannot accept liability for any damage which you may sustain as a result of software viruses which may be transmitted in or with the message.
Diamond Light Source Limited (company no. 4375679). Registered in England and Wales with its registered office at Diamond House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE, United Kingdom
2
1

23 Sep '20
Hi Billy,
I installed cctbx in a new conda env called cctbx37:
conda create --name cctbx37 python=3.7
conda activate cctbx37
conda install -c conda-forge cctbx jupyterlab
I cannot find libtbx.run_tests_module.
I can only find libtbx.run_tests_parallel.
Best regards,
Blaine
Blaine Mooers, Ph.D.
Associate Professor
Department of Biochemistry and Molecular Biology
College of Medicine
University of Oklahoma Health Sciences Center
S.L. Young Biomedical Research Center (BRC) Rm. 466
975 NE 10th Street, BRC 466
Oklahoma City, OK 73104-5419
________________________________________
From: cctbxbb-bounces(a)phenix-online.org [cctbxbb-bounces(a)phenix-online.org] on behalf of cctbxbb-request(a)phenix-online.org [cctbxbb-request(a)phenix-online.org]
Sent: Wednesday, September 23, 2020 2:00 PM
To: cctbxbb(a)phenix-online.org
Subject: [EXTERNAL] cctbxbb Digest, Vol 138, Issue 2
Send cctbxbb mailing list submissions to
cctbxbb(a)phenix-online.org
To subscribe or unsubscribe via the World Wide Web, visit
https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
or, via email, send a message with subject or body 'help' to
cctbxbb-request(a)phenix-online.org
You can reach the person managing the list at
cctbxbb-owner(a)phenix-online.org
When replying, please edit your Subject line so it is more specific
than "Re: Contents of cctbxbb digest..."
Today's Topics:
1. cctbx now available on conda-forge (Billy Poon)
----------------------------------------------------------------------
Message: 1
Date: Wed, 23 Sep 2020 11:22:03 -0700
From: Billy Poon <BKPoon(a)lbl.gov>
To: cctbx mailing list <cctbxbb(a)phenix-online.org>, PHENIX user
mailing list <phenixbb(a)phenix-online.org>
Subject: [cctbxbb] cctbx now available on conda-forge
Message-ID:
<CAHmYUcZwVDKZ6v1iuA-nP8AJn1cfp3sNWtiqeo=fcWPq9VbpqQ(a)mail.gmail.com>
Content-Type: text/plain; charset="utf-8"
Hi everyone,
The conda-forge package for cctbx is now available. There are 2 packages,
"cctbx-base" includes the base code and "cctbx" which includes "cctbx-base"
and adds "wxPython", "PySide2", and "ipython". The commands for installing
cctbx into your conda environment are
conda install -c conda-forge cctbx
or
conda install -c conda-forge cctbx-base
If you want to use Jupyter Lab, you can now easily do this with
conda install -c conda-forge cctbx-base jupyterlab
jupyter lab
The existing documentation will be updated to reflect the easier
installation procedure with conda.
After installing the conda package, you can also run some of the tests (in
an empty directory) with
libtbx.run_tests_module module=libtbx module=cctbx nproc=<nproc>
I do know of a few issues that I want to fix in upcoming releases, but
please submit issues to https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx… with steps
to reproduce the error.
Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
2
1
Hi everyone,
The conda-forge package for cctbx is now available. There are 2 packages,
"cctbx-base" includes the base code and "cctbx" which includes "cctbx-base"
and adds "wxPython", "PySide2", and "ipython". The commands for installing
cctbx into your conda environment are
conda install -c conda-forge cctbx
or
conda install -c conda-forge cctbx-base
If you want to use Jupyter Lab, you can now easily do this with
conda install -c conda-forge cctbx-base jupyterlab
jupyter lab
The existing documentation will be updated to reflect the easier
installation procedure with conda.
After installing the conda package, you can also run some of the tests (in
an empty directory) with
libtbx.run_tests_module module=libtbx module=cctbx nproc=<nproc>
I do know of a few issues that I want to fix in upcoming releases, but
please submit issues to https://github.com/cctbx/cctbx_project with steps
to reproduce the error.
Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
1
0
Hello Everyone,
I am trying to find how to perform the E value calculation using CCTBX. I am unable to find the method in the documentation. Can someone assist me, please?
Regards,
AC Research
3
2
Hi everyone,
Two pull requests were merged today that make some important changes.
1) The boost imports were moved to boost_adaptbx.boost. This avoids
claiming the main "boost" namespace. A common piece of code that will need
to be changed is
import boost.python
ext = boost.python.import_ext("your_boost_python_ext")
That can be changed to
import boost_adaptbx.boost.python as bp
ext = bp.import_ext("your_boost_python_ext")
Otherwise, a FutureWarning will be raised.
More information can be found at
https://github.com/cctbx/cctbx_project/issues/458
https://github.com/cctbx/cctbx_project/pull/470
https://github.com/cctbx/cctbx_project/pull/516
2) More dependency repositories were moved from cci.lbl.gov to GitHub. If
you use bootstrap.py to build cctbx, you will want to delete annlib,
ccp4io_adaptbx, clipper, eigen, gui_resources, tntbx. Using a newly updated
bootstrap.py, the copies from GitHub will be used instead.
More information can be found at
https://github.com/cctbx/cctbx_project/pull/408
Let us know if you have any questions. Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
1
0
Hi,
Does anybody know how to convert a miller array of unmerged data to an
mtz object? For merged data I do something like this:
mtzobj = millarr.as_mtz_dataset(column_root_label="I")
But if millarr contains multiple observations with the same hkl index.
Then the above code fails with the exception
cctbx Error: Duplicate entries in miller_indices array.
Any suggestions?
Many thanks,
Rob
--
Robert Oeffner, Ph.D.
Research Associate, The Read Group
Department of Haematology,
Cambridge Institute for Medical Research
University of Cambridge
Cambridge Biomedical Campus
The Keith Peters Building
Hills Road
Cambridge CB2 0XY
www.cimr.cam.ac.uk/investigators/read/index.html
tel: +44(0)1223 763234
--
This email has been checked for viruses by AVG.
https://www.avg.com
4
5

flex.histogram giving ArgumentError when arguments correct
by Winter, Graeme (DLSLtd,RAL,LSCI) 04 Aug '20
by Winter, Graeme (DLSLtd,RAL,LSCI) 04 Aug '20
04 Aug '20
H = flex.histogram(coords, data_min=0.0, data_max=dim, n_slots=dim)
Gives
Boost.Python.ArgumentError: Please report this error to dials-support(a)lists.sourceforge.net: Python argument types in
histogram.__init__(histogram)
did not match C++ signature:
__init__(_object*, double, double, double, scitbx::af::shared<long>, unsigned long)
__init__(_object*, scitbx::histogram<double, long> other, scitbx::af::const_ref<double, scitbx::af::trivial_accessor> data, double relative_tolerance=0.0001)
__init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor> data, double data_min, double data_max, unsigned long n_slots=1000, double relative_tolerance=0.0001)
__init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor> data, unsigned long n_slots=1000)
Despite
coords being
<scitbx_array_family_flex_ext.double object at 0x7fa8d671b5b0>
with shape
(31294944,)
and dim being 18093576 (i.e. integer)
and
h = flex.histogram(a, data_min=0, data_max=100, n_slots=100)
working fine in another context i.e. the calling convention is correct
This has so far cost a few hours, so what gives? How can this be holding it wrong? C++ code suggests that the bin types are long so this should be fine
Any hints?
Thanks Graeme
--
This e-mail and any attachments may contain confidential, copyright and or privileged material, and are for the use of the intended addressee only. If you are not the intended addressee or an authorised recipient of the addressee please notify us of receipt by returning the e-mail and do not use, copy, retain, distribute or disclose the information in or attached to the e-mail.
Any opinions expressed within this e-mail are those of the individual and not necessarily of Diamond Light Source Ltd.
Diamond Light Source Ltd. cannot guarantee that this e-mail or any attachments are free from viruses and we cannot accept liability for any damage which you may sustain as a result of software viruses which may be transmitted in or with the message.
Diamond Light Source Limited (company no. 4375679). Registered in England and Wales with its registered office at Diamond House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE, United Kingdom
2
5
Hi Folks,
Came up in conversation earlier - what version of Python are people using for their day-to-day development?
For what it’s worth I’m currently on a 3.6 base, though wondering about moving to e.g. 3.8
Cheers Graeme
--
This e-mail and any attachments may contain confidential, copyright and or privileged material, and are for the use of the intended addressee only. If you are not the intended addressee or an authorised recipient of the addressee please notify us of receipt by returning the e-mail and do not use, copy, retain, distribute or disclose the information in or attached to the e-mail.
Any opinions expressed within this e-mail are those of the individual and not necessarily of Diamond Light Source Ltd.
Diamond Light Source Ltd. cannot guarantee that this e-mail or any attachments are free from viruses and we cannot accept liability for any damage which you may sustain as a result of software viruses which may be transmitted in or with the message.
Diamond Light Source Limited (company no. 4375679). Registered in England and Wales with its registered office at Diamond House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE, United Kingdom
3
2
Hi Pavel,
Thank you very much for the leads.
They were very helpful.
I was able to make the desired plot.
Best regards,
Blaine
________________________________________
From: Pavel Afonine [pafonine(a)lbl.gov]
Sent: Tuesday, June 09, 2020 2:07 PM
To: Mooers, Blaine H.M. (HSC); cctbx mailing list
Subject: [EXTERNAL] Re: [cctbxbb] How to extract I(+) and I(-) from miller array?
Hi Blaine,
this is correct, this is how anomalous data are read in and stored in an
instance of miller.array class. In this case I(+) and I(-) will be
stored in one miller_array, anomalous_flag will be set to True, and
.indices() will contain 'plus' and 'minus' mates as well as singletons.
Now, if you want to get separate I(+) and I(-), for an example look in
def anomalous_signal(self, use_binning=False):
def anomalous_differences(self, enforce_positive_sigmas=False):
def hemisphere_acentrics(self, plus_or_minus):
def hemispheres_acentrics(self):
def convert_to_non_anomalous_if_ratio_pairs_lone_less_than(self,
threshold):
in cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit… .
Pavel
On 6/9/20 07:55, Mooers, Blaine H.M. (HSC) wrote:
> Dear CCTBX experts,
>
> The diffraction data for 3hz7 from RC Researcher's question includes one dataset with column labels of 'I(+)', 'SIGI(+)', 'I(-)', 'SIGI(-)'.
> When the diffraction data of 3hz7 data are read from a mtz file into miller arrays,
> it would appear that the I(+) and I(-) are stored in a single column of intensities rather than two parallel columns.
>
> from iotbx.reflection_file_reader import any_reflection_file
>
> hkl_file = any_reflection_file('3hz7.mtz')
> miller_arrays = hkl_file.as_miller_arrays(merge_equivalents=False)
> Iobs = miller_arrays[1]
> list(Iobs[100:105])
>
> [((7, 4, 38), 84.0, 52.20000076293945),
> ((-7, -4, -38), 112.80000305175781, 48.20000076293945),
> ((8, 4, 38), 119.69999694824219, 57.400001525878906),
> ((-8, -4, -38), 152.10000610351562, 65.9000015258789),
> ((6, 5, 38), 732.5, 57.5)]
>
> How would I extract the I(+) and I(-) into lists to plot against each other in a scatter plot in matplotlib?
>
>
> Best regards,
>
> Blaine
>
> Blaine Mooers, Ph.D.
> Associate Professor
> Department of Biochemistry and Molecular Biology
> College of Medicine
> University of Oklahoma Health Sciences Center
> S.L. Young Biomedical Research Center (BRC) Rm. 466
> 975 NE 10th Street, BRC 466
> Oklahoma City, OK 73104-5419
>
> _______________________________________________
> cctbxbb mailing list
> cctbxbb(a)phenix-online.org
> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
2
1
Dear CCTBX experts,
The diffraction data for 3hz7 from RC Researcher's question includes one dataset with column labels of 'I(+)', 'SIGI(+)', 'I(-)', 'SIGI(-)'.
When the diffraction data of 3hz7 data are read from a mtz file into miller arrays,
it would appear that the I(+) and I(-) are stored in a single column of intensities rather than two parallel columns.
from iotbx.reflection_file_reader import any_reflection_file
hkl_file = any_reflection_file('3hz7.mtz')
miller_arrays = hkl_file.as_miller_arrays(merge_equivalents=False)
Iobs = miller_arrays[1]
list(Iobs[100:105])
[((7, 4, 38), 84.0, 52.20000076293945),
((-7, -4, -38), 112.80000305175781, 48.20000076293945),
((8, 4, 38), 119.69999694824219, 57.400001525878906),
((-8, -4, -38), 152.10000610351562, 65.9000015258789),
((6, 5, 38), 732.5, 57.5)]
How would I extract the I(+) and I(-) into lists to plot against each other in a scatter plot in matplotlib?
Best regards,
Blaine
Blaine Mooers, Ph.D.
Associate Professor
Department of Biochemistry and Molecular Biology
College of Medicine
University of Oklahoma Health Sciences Center
S.L. Young Biomedical Research Center (BRC) Rm. 466
975 NE 10th Street, BRC 466
Oklahoma City, OK 73104-5419
2
1
Dear AC Researh,
To follow Pavel's suggestion, print your miller arrays, get their length, and then loop over the arrays and print the column labels.
len(miller_arrays) # which returns 2 for your example.
[print("Miller array %s: %s" % (i, miller_array.info().labels)) for i, miller_array in list(enumerate(miller_arrays))[:2]]
Best regards,
Blaine
Blaine Mooers, Ph.D.
Associate Professor
Department of Biochemistry and Molecular BiologyUniversity of Oklahoma Health Sciences Center
Oklahoma City, OK 73104-5419
________________________________________
From: cctbxbb-bounces(a)phenix-online.org [cctbxbb-bounces(a)phenix-online.org] on behalf of cctbxbb-request(a)phenix-online.org [cctbxbb-request(a)phenix-online.org]
Sent: Monday, June 08, 2020 2:00 PM
To: cctbxbb(a)phenix-online.org
Subject: [EXTERNAL] cctbxbb Digest, Vol 135, Issue 1
Send cctbxbb mailing list submissions to
cctbxbb(a)phenix-online.org
To subscribe or unsubscribe via the World Wide Web, visit
https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
or, via email, send a message with subject or body 'help' to
cctbxbb-request(a)phenix-online.org
You can reach the person managing the list at
cctbxbb-owner(a)phenix-online.org
When replying, please edit your Subject line so it is more specific
than "Re: Contents of cctbxbb digest..."
Today's Topics:
1. F_obs values (Academic Research)
2. Re: F_obs values (Pavel Afonine)
----------------------------------------------------------------------
Message: 1
Date: Sun, 07 Jun 2020 21:34:50 -0000
From: Academic Research <ac.research(a)icloud.com>
To: cctbxbb(a)phenix-online.org
Subject: [cctbxbb] F_obs values
Message-ID: <9b1bc3ab-2421-4faa-b6f4-fd1ecd63415a(a)me.com>
Content-Type: text/plain; charset="utf-8"; Format="flowed"
Hello Everyone,
I am trying to follow the script on the CCTBX website to get the F_obs values for my 3hz7.mtz file.
my code is as follows:
from iotbx.reflection_file_reader import any_reflection_file
hkl_file = any_reflection_file('3hz7.mtz')
arrays = hkl_file.as_miller_arrays(merge_equivalents=False)
a = arrays[0]
f_obs = a.f_sq_as_f().map_to_asu()
I get this following error:
Traceback (most recent call last):
? File "https://urldefense.proofpoint.com/v2/url?u=http-3A__crystal.py&d=DwICAg&c=V… ", line 143, in <module>
??? if __name__ == '__main__': main()
? File "https://urldefense.proofpoint.com/v2/url?u=http-3A__crystal.py&d=DwICAg&c=V… ", line 140, in main
??? Cls.features('3hz7.mtz')
? File "https://urldefense.proofpoint.com/v2/url?u=http-3A__crystal.py&d=DwICAg&c=V… ", line 63, in features
??? f_obs = a.f_sq_as_f().map_to_asu()
? File "/home/acresearch/Desktop/CCTBX/mc3/envs/tenv/lib/python3.8/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=oAfuCKnHEMReNwNf8K-J-MEXUEuhmfZEy8PYiJVy68I&s=LeX7G1Xgo9XI-pi0Su5OxLY6PfDhKilIfshCkSXXcPU&e= ", line 2374, in f_sq_as_f
??? result = array(self, converter(self.data()).f)
Boost.Python.ArgumentError: Python argument types in
??? array_f_sq_as_f_xtal_3_7.__init__(array_f_sq_as_f_xtal_3_7, int)
did not match C++ signature:
??? __init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>)
??? __init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>)
??? __init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, double)
When I run:
print(i_obs.info())
I get:
3hz7.mtz:FREE
print(a.observation_type())
gives:
None
I repeated this script to many structure from the PDB (all solved by x-rays) yet I get the exact same output for all of them.
How can I get the F_obs values? Can someone please assist me?
Regards,
AC Research
1
0
Hello Everyone,
I am trying to follow the script on the CCTBX website to get the F_obs values for my 3hz7.mtz file.
my code is as follows:
from iotbx.reflection_file_reader import any_reflection_file
hkl_file = any_reflection_file('3hz7.mtz')
arrays = hkl_file.as_miller_arrays(merge_equivalents=False)
a = arrays[0]
f_obs = a.f_sq_as_f().map_to_asu()
I get this following error:
Traceback (most recent call last):
File "crystal.py", line 143, in <module>
if __name__ == '__main__': main()
File "crystal.py", line 140, in main
Cls.features('3hz7.mtz')
File "crystal.py", line 63, in features
f_obs = a.f_sq_as_f().map_to_asu()
File "/home/acresearch/Desktop/CCTBX/mc3/envs/tenv/lib/python3.8/site-packages/cctbx/miller/__init__.py", line 2374, in f_sq_as_f
result = array(self, converter(self.data()).f)
Boost.Python.ArgumentError: Python argument types in
array_f_sq_as_f_xtal_3_7.__init__(array_f_sq_as_f_xtal_3_7, int)
did not match C++ signature:
__init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>)
__init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>)
__init__(_object*, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, scitbx::af::const_ref<double, scitbx::af::trivial_accessor>, double)
When I run:
print(i_obs.info())
I get:
3hz7.mtz:FREE
print(a.observation_type())
gives:
None
I repeated this script to many structure from the PDB (all solved by x-rays) yet I get the exact same output for all of them.
How can I get the F_obs values? Can someone please assist me?
Regards,
AC Research
2
1
Hi everyone,
There is currently a pull request for cctbx that will update Boost to 1.70 (
https://github.com/cctbx/cctbx_project/pull/409). The update enables
support for Python 3.7 and 3.8. The plan is to merge this next Friday, May
8, at 3 pm Pacific. After merging, developers should delete the
build/lib/*boost* files and build/boost directory so that any remnants of
the old Boost are removed and then rebuild.
Let me know if you have any questions. Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
1
1
Dear CCTBX developers,
I am a postdoc at EPFL working with HHpred for homology modeling of membrane proteins.
I have been trying to write my own HHpred alignment parser until I found the python script under “cctbx_fork/iotbx/bioinformatics/__init__.py/” that contains an HHpred parser.
My goal is to correctly parse the raw HHpred output file (.hhr), which involves unwrapping every alignment, parsing out a lot of text to finally obtain something like this:
>pdb_name
query-sequence
column score
Example:
>4U15
VYGFIGGIFGFMSIMTMAMISIDRYNVIGRPMAASKKMSHRRAFIMIIFVWLWS
+........+..+..++|+++|++++.++.+.++++ +..+.++.+|+++|++.++...+........ +...|..
Being somewhat new to python, I was wondering whether the people who wrote this script are still around and could help me figure out whether the parser could be implemented in such a way.
Thanks for any help you can provide!
Best,
Louis D
2
1

23 Mar '20
Hello,
I'm trying to find something I can run from Python to get all the special (high-symmetry) positions and usual (e.g. Wyckoff) labels for a particular space group. I can't find this in the sgtbx documentation. Does anyone know if it can be done? Or maybe a different package?
Thanks - and stay safe!
Steve Collins
--
This e-mail and any attachments may contain confidential, copyright and or privileged material, and are for the use of the intended addressee only. If you are not the intended addressee or an authorised recipient of the addressee please notify us of receipt by returning the e-mail and do not use, copy, retain, distribute or disclose the information in or attached to the e-mail.
Any opinions expressed within this e-mail are those of the individual and not necessarily of Diamond Light Source Ltd.
Diamond Light Source Ltd. cannot guarantee that this e-mail or any attachments are free from viruses and we cannot accept liability for any damage which you may sustain as a result of software viruses which may be transmitted in or with the message.
Diamond Light Source Limited (company no. 4375679). Registered in England and Wales with its registered office at Diamond House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE, United Kingdom
5
6
Hi everyone,
Sorry for the long delay, the current Phenix release and helping out with
an experiment at SACLA earlier in the year, took priority. But I have been
able to clean up the cctbx conda packages that I built at the end of last
year. The major differences are as follows.
1) Windows packages are available for Python 2.7, 3.6, and 3.7. It's not
clear why conda-build is having issues with Python 3.8, so I'm still
sorting it out.
2) The full repositories are copied now. As a consequence, you'll be able
to run some tests like "libtbx.run_tests_parallel module=cctbx nproc=24"
and all the tests will run.
3) The LIBTBX_BUILD environment variable is no longer needed, so it is not
set on activation of the conda environment.
4) The libtbx.configure and libtbx.refresh commands are removed from the
conda package until the ability to configure/build against the conda
installation of cctbx is available. Currently, those commands will break
the environment.
The linux and macOS packages support Python 2.7, 3.6, 3.7, and 3.8, just
like before. The command to create a new environment is,
conda create -n test -c cctbx-dev cctbx python=<python version>
If "python=<python version>" is left out, the default Python version will
be 3.8. To install cctbx into the currently active conda environment, the
command is,
conda install -c cctbx-dev cctbx
The packages are currently on the cctbx-dev channel, but the goal is to get
official packages into conda-forge. To get the cctbx recipe into
conda-forge (https://github.com/conda-forge/staged-recipes/pull/10021),
we'll need an official release. I've opened up an issue on GitHub (
https://github.com/cctbx/cctbx_project/issues/451). Please provide any
feedback on the versioning system, release schedule, and anything release
related.
Let us know if you're scripts are not working with these packages. Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
3
4
Morning all,
Looking at commits overnight saw
https://github.com/cctbx/cctbx_project/commit/69d506ebd0ac212b8166eec98a8d8…
which adds Python 2 only code to cctbx - I thought there were things in place which prevent regressions such as this?
Error: the following jobs returned non-zero exit codes or suspicious stderr output:
libtbx.python "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/tst_hierarchy.py" [FAIL] 1.0s
Time: 1.04
Return code: 1
OKs: 0
Standard error:
Traceback (most recent call last):
File "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/tst_hierarchy.py", line 7082, in <module>
exercise(sys.argv[1:])
File "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/tst_hierarchy.py", line 7069, in exercise
exercise_other()
File "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/tst_hierarchy.py", line 5845, in exercise_other
assert pdb_hierarchy.contains_protein()
File "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/hierarchy.py", line 1623, in contains_protein
classes=['common_amino_acid', 'modified_amino_acid'])
File "/Users/graeme/svn/cctbx/modules/cctbx_project/iotbx/pdb/hierarchy.py", line 214, in get_n_residues_of_classes
for resname, count in self.resnames.iteritems():
AttributeError: 'dict' object has no attribute ‘iteritems’
Given how much noise you will receive if you leave trailing whitespace in there, I’d like to think real errors like this would be picked up automatically?
Cheers Graeme
--
This e-mail and any attachments may contain confidential, copyright and or privileged material, and are for the use of the intended addressee only. If you are not the intended addressee or an authorised recipient of the addressee please notify us of receipt by returning the e-mail and do not use, copy, retain, distribute or disclose the information in or attached to the e-mail.
Any opinions expressed within this e-mail are those of the individual and not necessarily of Diamond Light Source Ltd.
Diamond Light Source Ltd. cannot guarantee that this e-mail or any attachments are free from viruses and we cannot accept liability for any damage which you may sustain as a result of software viruses which may be transmitted in or with the message.
Diamond Light Source Limited (company no. 4375679). Registered in England and Wales with its registered office at Diamond House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11 0DE, United Kingdom
1
0

IUCr2020 Computing School in Nove Hrady - 17th to 22nd August - Registration opened
by Claudia Millán Nebot 24 Feb '20
by Claudia Millán Nebot 24 Feb '20
24 Feb '20
Dear all,
We announce the IUCr Computing School in Nove Hrady (Czech Republic) which
will take place between 17th and 22nd August 2020 prior to the IUCr
Congress in Prague. Registration has already started. Further information
about the school can be found on the website:
https://www.xray.cz/iucr/workshops/nh/default.htm. Follow also our hashtag
on Twitter, #IUCr2020CompSchool.
Active developers of crystallographic software, tools and methods are
invited to participate at this Computing School. The school is not
introductory and it is recommended that participants already have some
basic programming skills and crystallographic knowledge. Our aim is to
discuss and exchange ideas and to tackle the challenges related to the
method development in crystallography. Participants can be early-career
scientists (PhD students, Postdocs, etc.) as well as established developers.
Our confirmed speakers are:
-
Simon Billinge (Columbia University, USA)
-
Luc Bourhis (Bruker, France)
-
Paul Boyle (Western University, London, Ontario, Canada)
-
Iracema Caballero (Institut de Biologia Molecular de Barcelona, Spain)
-
Gemma de la Flor (Karlsruhe Institute of Technology, Germany)
-
Dorothee Liebschner (Lawrence Berkeley National Laboratory, USA)
-
Rafiga Masmaliyeva (Institute of Molecular Biology and Biotechnology,
Azerbaijan)
-
Garib Murshudov (Laboratory of Molecular Biology-MRC, UK)
-
Reinhard Neder (Institute of Condensed Matter Physics, Erlangen, Germany)
-
Alexandre Ourjoumtsev (Institut de Génétique et de Biologie Moléculaire
et Cellulaire, France)
-
Randy Read (University of Cambridge, UK)
-
Massimo Sammito (University of Cambridge, UK)
-
Arkadiy Simonov (Eidgenössische Technische Hochschule Zürich,
Switzerland)
-
Melanie Vollmar (Diamond Light Source Ltd, Harwell Science & Innovation
Campus, United Kingdom)
-
Thomas White (Center for Free-Electron Laser Science, Hamburg, Germany)
For any questions regarding the school please contact us.
Best wishes,
Claudia Millán (cmncri at ibmb.csic.es)
Martin Lutz (m.lutz at uu.nl)
Jan Rohlicek (rohlicek at fzu.cz)
PD. Please find attached a poster about the school that you can forward,
together with this email, to people potentially interested in participating
in the Computing School.
1
0
I am confused about grid sizes of maps.
When i specify a grid size for an fft_map but then pull the numpy array out for direct manimpulation, it's always 2 larger in the last dimension.
Why is it not the same size? Any help appreciated.
George
y# Now make initial (smoothed) map using random phases with Fobs
f_obs_B = f_obs1.apply_debye_waller_factors( b_iso=biso_init)
phases = f_obs_B.random_phases_compatible_with_phase_restrictions(deg=False)
phases_data = phases.data()
e_map_coeff = f_obs_B.phase_transfer(phase_source = phases_data)
e_map = e_map_coeff.fft_map(crystal_gridding = crystal_gridding, symmetry_flags = maptbx.use_space_group_symmetry)
print("cgridding", crystal_gridding.n_real())
# pick initial envelope
e_map_array = e_map.real_map().as_numpy_array()
print("e_map", e_map_array.shape)
cgridding (90, 90, 80)
e_map (90, 90, 82)
George N. Phillips, Jr., Ph.D.
Professor Emeritus
University of Wisconsin-Madison
433 Babcock Dr. Madison, Wi 53706
Phone 713 348 6951 (Houston)
4
3
I am starting to write some python code using cctbx, but am missing how to use the C++ bindings.
I am fine unless a try to access them. Something about my environment or boost of something.
Can anyone point me in the right direction?
I have
import boost.python
but am cleary missing some fundamental knowledge.
George
Traceback (most recent call last):
File "/Users/georgep/PycharmProjects/test_env/HIO_Version3.py", line 225, in <module>
S0 = percentile[rho_calc_true > percentile(rho_calc_true, solv_frac)] = 1
File "/Users/georgep/PycharmProjects/test_env/HIO_Version3.py", line 216, in percentile
order = flex.sort_permutation(x)
Boost.Python.ArgumentError: Python argument types in
scitbx_array_family_flex_ext.sort_permutation(double)
did not match C++ signature:
sort_permutation(scitbx::af::const_ref<double, scitbx::af::trivial_accessor> data, bool reverse=False, bool stable=True)
sort_permutation(scitbx::af::const_ref<unsigned long, scitbx::af::trivial_accessor> data, bool reverse=False, bool stable=True)
sort_permutation(scitbx::af::const_ref<int, scitbx::af::trivial_accessor> data, bool reverse=False, bool stable=True)
George N. Phillips, Jr.
Ralph and Dorothy Looney Professor
BioSciences at Rice
Rice University, MS140
6100 Main Street
Houston, Texas 77005-1892
Office: +1 713.348.6951
www.phillipslab.org
2
1
Hi everyone,
During this year's ECM computing school, it came up that the CCTBX does not
have a lot of documentation. This seems to be a major reason why people
don't use it, even if they would like to employ the libraries.
We would like to find out which parts of the CCTBX are the most interesting
for users. We certainly cannot provide extensive documentation for the
entire toolbox, but we can see what we can do once we know the main areas
of interest.
So if you were in the situation of wanting to use the CCTBX but decided to
stay away from it because the documentation was non-existent or obscure,
please let us know by filling out the questionnaire below (it's anonymous):
questionnaire CCTBX documentation <https://forms.gle/9RawJFfHyEvhCVVP7>
Best wishes,
Dorothee
--
Project Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
11
40

05 Jan '20
Hi Tristan,
Thank you very much for the explanation and the suggested solution.
I needed both.
When I tried your list comprehension in a Jupyter notebook with the orginal
problem, it is too fast:
```
IOPub data rate exceeded.
The notebook server will temporarily stop sending output
to the client in order to avoid crashing it.
To change this limit, set the config variable
`--NotebookApp.iopub_data_rate_limit`.
Current values:
NotebookApp.iopub_data_rate_limit=1000000.0 (bytes/sec)
NotebookApp.rate_limit_window=3.0 (secs)
```
When I reduced the a and b edges by an order of magnitude (now 12,118 reflections),
your list comprehension is two orders of magnitude faster a for loop (no surprise).
It is also slightly faster than this generator expression coupled to a list
comprehension, so there is no advantage to using the generator here.
hklgen = (hkl for hkl in ms.indices())
print('\n'.join([str(hkl) for hkl in hklgen]))
Best regards,
Blaine
________________________________________
From: Tristan Croll [tic20(a)cam.ac.uk]
Sent: Sunday, January 05, 2020 4:13 AM
To: cctbx mailing list
Cc: Mooers, Blaine H.M. (HSC)
Subject: [EXTERNAL] Re: [cctbxbb] conda cctbx on Mac 10.15.2 working with python3.8
Hi Blaine,
The speed issue is probably because this list comprehension:
[print(hkl) for hkl in ms.indices()]
... is calling print() (and returning None) a million times over. I
think something like the following should be much faster:
print('\n'.join([str(hkl) for hkl in ms.indices()]))
Best regards,
Tristan
On 2020-01-04 22:00, Mooers, Blaine H.M. (HSC) wrote:
> Hi Billy,
>
> Gergely's post yesterday stimulated me to check my conda cctbx setup.
> I had earlier reported success with conda cctbx for Python3.6, 3.7, and
> 3.8.
> This morning I found in my path an earlier python3.6 build of cctbx
> that may
> have given me false positives with my conda installs of cctbx.
> After removing the old build of cctbx from my path, I modified my zshrc
> file
> as Gergely suggested. I can confirm that results that Gergely reported
> yesterday.
>
> I used a Mac OS X 10.15.2 with zsh as my shell and anaconda3 installed
> as /opt/anaconda. I did my testing in a conda env named cctbx38.
> I added 'export LIBTBX_BUILD=$CONDA_PREFIX' in my .zshrc file.
> After sourcing my .zshrc file, 'echo $LIBTBX_BUILD' returns
> '/opt/anaconda/envs/cctbx38' as expected.
>
> The toy script below prints the calculated Miller indices as a tuples
> in a terminal window.
> It was run using 'python https://urldefense.proofpoint.com/v2/url?u=http-3A__millerSet.py&d=DwICAg&c… '.
>
> Note that the printing of 1 million indices to a jupyter notebook cell
> is disappointingly slow!!
> Reduce each unit cell dimension by two orders of magnitude before
> trying this at home!
> The following code also worked with Python3.6 and Python3.7 in their
> corresponding cctbx36 and cctbx37 envs.
>
> from cctbx import crystal
> from cctbx import miller
>
> ms = miller.build_set(
> crystal_symmetry=crystal.symmetry(
> space_group_symbol='P4',
> unit_cell=(150.8,150.8,250.4,90.0,90.0,90.0)),
> anomalous_flag=False,
> d_min=1.4)
>
> [print(hkl) for hkl in ms.indices()]
>
> I used conda python3.8.0 built on November 22. Python3.8.1 does not
> seem to be
> available yet from Anaconda.
>
> Best regards,
>
> Blaine
>
> Blaine Mooers, Ph.D.
> Associate Professor
> Department of Biochemistry and Molecular Biology
> College of Medicine
> University of Oklahoma Health Sciences Center
> S.L. Young Biomedical Research Center (BRC) Rm. 466
> 975 NE 10th Street, BRC 466
> Oklahoma City, OK 73104-5419
>
> ________________________________________
> From: cctbxbb-bounces(a)phenix-online.org
> [cctbxbb-bounces(a)phenix-online.org] on behalf of
> cctbxbb-request(a)phenix-online.org [cctbxbb-request(a)phenix-online.org]
> Sent: Saturday, January 04, 2020 2:00 PM
> To: cctbxbb(a)phenix-online.org
> Subject: [EXTERNAL] cctbxbb Digest, Vol 130, Issue 2
>
> Send cctbxbb mailing list submissions to
> cctbxbb(a)phenix-online.org
>
> To subscribe or unsubscribe via the World Wide Web, visit
>
> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> or, via email, send a message with subject or body 'help' to
> cctbxbb-request(a)phenix-online.org
>
> You can reach the person managing the list at
> cctbxbb-owner(a)phenix-online.org
>
> When replying, please edit your Subject line so it is more specific
> than "Re: Contents of cctbxbb digest..."
>
>
> Today's Topics:
>
> 1. Re: some thoughts on cctbx and pip (Billy Poon)
>
>
> ----------------------------------------------------------------------
>
> Message: 1
> Date: Fri, 3 Jan 2020 21:04:25 +0100
> From: Billy Poon <BKPoon(a)lbl.gov>
> To: cctbx mailing list <cctbxbb(a)phenix-online.org>
> Subject: Re: [cctbxbb] some thoughts on cctbx and pip
> Message-ID:
>
> <CAHmYUcbWS7FXA6EPUx=AC2X6m6gPY=GqH-MwGD+uzpTaOKSyjQ(a)mail.gmail.com>
> Content-Type: text/plain; charset="utf-8"
>
> Hi Gergely,
>
> Happy New Year!
>
> Can you provide the output to "conda list" for each environment?
>
> I suspect that the old version of cctbx might still be around. Is there
> a
> file named PYTHON_VERSION_MAJOR_MINOR in "/home/gergely/anaconda3/lib"?
> If
> so, delete that file. To make sure you are downloading a new copy of
> the
> package, clear the cache where conda keeps copies of all the packages.
> To
> do that, you can run "conda clean -y --all". You can remove the "-y"
> flag
> if you want to see what will be deleted. The hash for the new linux
> package
> should be h8b68381_0.
>
> The last error looks like an incompatible version of boost or gcc
> library
> was installed. The output from "conda list" should show the boost and
> boost-cpp packages coming from conda-forge. I would avoid installing
> into
> the root or base environment because that usually pulls from the
> default
> channels. All the dependencies should be pulled from the conda-forge
> channel.
>
> --
> Billy K. Poon
> Research Scientist, Molecular Biophysics and Integrated Bioimaging
> Lawrence Berkeley National Laboratory
> 1 Cyclotron Road, M/S 33R0345
> Berkeley, CA 94720
> Tel: (510) 486-5709
> Fax: (510) 486-5909
> Web:
> https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>
>
> On Fri, Jan 3, 2020 at 2:20 PM Gergely Katona <gkatona(a)gmail.com>
> wrote:
>
>> I found some other errors when using the test environment.
>>
>>
>> ---------------------------------------------------------------------------
>> RuntimeError Traceback (most recent call
>> last)
>> <ipython-input-1-fe308b345b3f> in <module>
>> 10 import scipy as sp
>> 11 from scipy import linalg
>> ---> 12 import iotbx.pdb
>> 13 import cctbx
>> 14 import pandas as pd
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in <module>
>> 8
>> 9 import iotbx.pdb.records
>> ---> 10 import iotbx.pdb.hierarchy
>> 11 from scitbx import matrix
>> 12
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__hierarchy.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=QlonHINbJqyu1vTwlBJWKyChCMCCJxpIWIaT5_rrkLc&e=
>> in <module>
>> 14 from six.moves import cStringIO as StringIO
>> 15 from iotbx.pdb import hy36encode, hy36decode
>> ---> 16 import iotbx.cif.model
>> 17 from cctbx import crystal
>> 18 from libtbx import group_args
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/cif/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in <module>
>> 19
>> 20 from cctbx.array_family import flex
>> ---> 21 from cctbx import miller
>> 22 from iotbx.cif import model, builders, geometry
>> 23 from libtbx.containers import OrderedDict
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in <module>
>> 11
>> 12 from cctbx import crystal
>> ---> 13 from cctbx import maptbx
>> 14 from cctbx import sgtbx
>> 15 from cctbx.sgtbx import lattice_symmetry
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/cctbx/maptbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in <module>
>> 15 from libtbx import adopt_init_args
>> 16 from libtbx.utils import Sorry
>> ---> 17 import libtbx.load_env
>> 18 import math
>> 19 import sys, os
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e=
>> in
>> <module>
>> 3 import libtbx.env_config
>> 4 import os
>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
>> 6 libtbx.env.set_os_environ_all_dist()
>> 7 libtbx.env.dispatcher_name =
>> os.environ.get("LIBTBX_DISPATCHER_NAME")
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e=
>> in unpickle()
>> 2736 env = pickle.load(libtbx_env)
>> 2737 if (env.python_version_major_minor != sys.version_info[:2]):
>> -> 2738 env.raise_python_version_incompatible()
>> 2739 if (op.realpath(build_path) !=
>> op.realpath(abs(env.build_path))):
>> 2740 env.build_path.reset(build_path)
>>
>> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e=
>> in raise_python_version_incompatible(self, prev_pvmm)
>> 469 if (prev_pvmm is None):
>> 470 prev_pvmm = "%d.%d" % self.python_version_major_minor
>> --> 471 raise RuntimeError("Python version incompatible with this
>> build:\n"
>> 472 + " Build directory: %s\n" %
>> show_string(abs(self.build_path))
>> 473 + " Python version used initially: %s\n" % prev_pvmm
>>
>> RuntimeError: Python version incompatible with this build:
>> Build directory: "/home/gergely/anaconda3"
>> Python version used initially: 3.6
>> Python version in use now: 3.8
>>
>>
>> Interestingly in the base environment all import worked, but I got an
>> error at:
>>
>>
>> ArgumentError Traceback (most recent call
>> last)
>> <ipython-input-4-5bc71c36e121> in <module>
>> 33 atm_odd.set_b(0)
>> 34
>> ---> 35 odd.write_pdb_file("bdiff_in_even_000.pdb") #skriver ny pdb
>> med dessa inkluderade
>> 36 dfWBvals=pd.DataFrame(rows_list)
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in
>> write_pdb_file(self, file_name, open_append, crystal_symmetry,
>> cryst1_z, write_scale_records, append_end, atom_hetatm, sigatm,
>> anisou, siguij)
>> 930 siguij=True):
>> 931 if (crystal_symmetry is Auto):
>> --> 932 crystal_symmetry = self.crystal_symmetry()
>> 933 if (cryst1_z is Auto):
>> 934 cryst1_z = self.extract_cryst1_z_columns()
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in
>> crystal_symmetry(self, crystal_symmetry, weak_symmetry)
>> 1218 crystal_symmetry=None,
>> 1219 weak_symmetry=False):
>> -> 1220 self_symmetry = self.crystal_symmetry_from_cryst1()
>> 1221 if (self_symmetry is None):
>> 1222 self_symmetry =
>> self._crystal_symmetry_from_cns_remark_sg()
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in
>> crystal_symmetry_from_cryst1(self)
>> 1195 for line in self.crystallographic_section():
>> 1196 if (line.startswith("CRYST1")):
>> -> 1197 return
>> cryst1_interpretation.crystal_symmetry(cryst1_record=line)
>> 1198 return None
>> 1199
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__cryst1-5Finterpretation.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=3OchLb18AMp3YpXOuEb8BDOwhl2XLrV1QAfZByH-l2E&e=
>> in crystal_symmetry(cryst1_record)
>> 136 space_group_info=None)
>> 137 space_group_info =
>> categorize(cryst1_record.sgroup).space_group_info(
>> --> 138 unit_cell=u)
>> 139 return crystal.symmetry(unit_cell=u,
>> space_group_info=space_group_info)
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__cryst1-5Finterpretation.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=3OchLb18AMp3YpXOuEb8BDOwhl2XLrV1QAfZByH-l2E&e=
>> in space_group_info(self, unit_cell)
>> 85 if (self.symbol is None): return None
>> 86 if (self.category is None):
>> ---> 87 try: return sgtbx.space_group_info(self.symbol)
>> 88 except RuntimeError: return None
>> 89 if (isinstance(unit_cell, uctbx.ext.unit_cell)):
>>
>> ~/anaconda3/lib/python3.6/site-packages/cctbx/sgtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
>> in
>> __init__(self, symbol, table_id, group, number, space_group_t_den)
>> 100 assert group is None
>> 101 if (table_id is None):
>> --> 102 symbols = space_group_symbols(symbol)
>> 103 else:
>> 104 if (isinstance(symbol, int)): symbol = str(symbol)
>>
>> ArgumentError: Python argument types in
>> space_group_symbols.__init__(space_group_symbols, str)
>> did not match C++ signature:
>> __init__(_object*, int space_group_number)
>> __init__(_object*, int space_group_number,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > extension='')
>> __init__(_object*, int space_group_number,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > extension='', std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > table_id='')
>> __init__(_object*, std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > symbol)
>> __init__(_object*, std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > symbol,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > table_id='')
>>
>>
>> Gergely
>>
>>
>>
>> On Fri, Jan 3, 2020 at 1:44 PM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> >
>> > Dear Billy,
>> >
>> > I did some tests installing in my base conda was not troublefree in
>> > python 3.8. Running iotbx.fetch_pdb --all --mtz 1kp8 resulted in boost
>> > related error when converting to mtz. Installing into a test
>> > environment went fine with iotbx.fetch_pdb --all --mtz 1kp8 running
>> > successfully. I could add pymc3, jupyter and seaborn and iotbx still
>> > did not break. My LIBTBX_BUILD is not set however in the test
>> > environment, which breaks miller when I was trying to import it.
>> > Manually setting the LIBTBX_BUILD to CONDA_PREFIX (setenv LIBTBX_BUILD
>> > $CONDA_PREFIX) fixes this and one of my script works fine! I will come
>> > back if I find some problems with my other scripts, but so far this
>> > looks promising!
>> >
>> >
>> > Happy new year!
>> >
>> > Gergely
>> >
>> >
>> >
>> >
>> >
>> > On Fri, Dec 20, 2019 at 8:16 PM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> > >
>> > > Hi everyone,
>> > >
>> > > I updated the conda packages on the cctbx-dev channel and there are
>> also now packages for macOS. The old packages have been removed so you
>> can
>> create a new environment with
>> > >
>> > > conda create -n test -c cctbx-dev cctbx python=2.7
>> > > conda activate test
>> > >
>> > > where "test" is the environment name and 2.7 is the python version.
>> For the python version, you can also pick 3.6, 3.7, or 3.8. I think
>> the
>> latest conda will install 3.8 as the default python if the python
>> argument
>> is not provided. Or install into an existing environment (with python
>> already installed) with the same command as before,
>> > >
>> > > conda install -c cctbx-dev cctbx
>> > >
>> > > Again, your .condarc file should have conda-forge as the first channel
>> so that dependencies can be pulled correctly.
>> > >
>> > > The dispatchers should work now and $LIBTBX_BUILD will be set on
>> activation of an environment (and unset on environment deactivation)
>> or
>> after installing into an existing environment, so you can do more
>> interesting things like
>> > >
>> > > iotbx.fetch_pdb --all --mtz 1kp8
>> > >
>> > > However, this package does not install databases, so
>> > >
>> > > molprobity.molprobity 1kp8.pdb 1kp8.mtz
>> > >
>> > > will fail because the database is not available (also probe and reduce
>> are not built).
>> > >
>> > > Some known issues in no particular order,
>> > >
>> > > 1) You can run "libtbx.run_tests_parallel module=cctbx nproc=Auto" to
>> run tests, but not all the test files were copied, so I got 30
>> failures
>> here. The final package will probably not have the test files.
>> > > 2) The other python dispatchers, like "cctbx.python", were not
>> updated, so those will fail. But you can just run "python" in the
>> active
>> environment.
>> > > 3) Parts of mmtbx still need to be updated for Python 3.
>> > > 4) The LIBTBX_BUILD variable should be set for sh and csh shells. Let
>> me know if it's not working for your shell (i.e. "echo $LIBTBX_BUILD"
>> should show the same thing as $CONDA_PREFIX).
>> > > 5) One future step is to enable building other CCTBX-like modules with
>> this conda package. This will require some bookkeeping updates so that
>> modules in the conda environment and the modules being built are
>> tracked
>> properly. Also, making sure that all the necessary headers exist in
>> $PREFIX/include.
>> > >
>> > > Gergely, let me know if your scripts are working.
>> > >
>> > > Happy holidays!
>> > >
>> > > --
>> > > Billy K. Poon
>> > > Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> > > Lawrence Berkeley National Laboratory
>> > > 1 Cyclotron Road, M/S 33R0345
>> > > Berkeley, CA 94720
>> > > Tel: (510) 486-5709
>> > > Fax: (510) 486-5909
>> > > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >
>> > >
>> > > On Wed, Dec 18, 2019 at 11:25 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> > >>
>> > >> Hi Gergely,
>> > >>
>> > >> That's the other information that hasn't been updated yet in the
>> conda package. :)
>> > >>
>> > >> For LIBTBX_BUILD, I can set up environment variables sort of how the
>> conda gcc package sets up environment variables. I have to double
>> check to
>> see if they're set after installation of the package and after
>> activation
>> of an environment. The variable will just be a copy of $CONDA_PREFIX.
>> > >>
>> > >> The libtbx_env file is a file that exists in $LIBTBX_BUILD that
>> basically stores configuration information. I'll have to modify the
>> contents to update the locations of the different modules since the
>> conda
>> package will not have a "modules" directory.
>> > >>
>> > >> --
>> > >> Billy K. Poon
>> > >> Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> > >> Lawrence Berkeley National Laboratory
>> > >> 1 Cyclotron Road, M/S 33R0345
>> > >> Berkeley, CA 94720
>> > >> Tel: (510) 486-5709
>> > >> Fax: (510) 486-5909
>> > >> Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >>
>> > >>
>> > >> On Wed, Dec 18, 2019 at 2:08 AM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> > >>>
>> > >>> Hi Billy,
>> > >>>
>> > >>> Conda install went fine with your instructions after rearranging the
>> > >>> channels by putting cctbx last. I removed all environmental variables
>> > >>> and previous build of cctbx.
>> > >>>
>> > >>> import sys
>> > >>> print (sys.path, sys.prefix)
>> > >>>
>> > >>> ['/home/gergely/anaconda3/lib/https://urldefense.proofpoint.com/v2/url?u=http-3A__python36.zip&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=cUHL8qgeloeUO3oYTQcr9d56RegJk01wJ2i-c3Zo6oE&e= ',
>> > >>> '/home/gergely/anaconda3/lib/python3.6',
>> > >>> '/home/gergely/anaconda3/lib/python3.6/lib-dynload', '',
>> > >>> '/home/gergely/anaconda3/lib/python3.6/site-packages',
>> > >>>
>> '/home/gergely/anaconda3/lib/python3.6/site-packages/IPython/extensions',
>> > >>> '/home/gergely/.ipython'] /home/gergely/anaconda3
>> > >>>
>> > >>> Many imports went fine including pymc3, but I encountered problems
>> > >>> with these three:
>> > >>>
>> > >>> from cctbx import miller
>> > >>> import iotbx.pdb
>> > >>> from iotbx import reflection_file_reader, mtz
>> > >>>
>> > >>>
>> > >>> I also got type error when handling space groups.
>> > >>>
>> > >>>
>> > >>>
>> > >>>
>> ---------------------------------------------------------------------------
>> > >>> KeyError Traceback (most recent
>> call last)
>> > >>> <ipython-input-5-cedbd4f84f3d> in <module>
>> > >>> 25 from cctbx import uctbx
>> > >>> 26 from cctbx import sgtbx
>> > >>> ---> 27 from cctbx import miller
>> > >>> 28 #from iotbx import reflection_file_reader, mtz
>> > >>> 29 sns.set_context("poster")
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
>> <module>
>> > >>> 11
>> > >>> 12 from cctbx import crystal
>> > >>> ---> 13 from cctbx import maptbx
>> > >>> 14 from cctbx import sgtbx
>> > >>> 15 from cctbx.sgtbx import lattice_symmetry
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/maptbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
>> <module>
>> > >>> 15 from libtbx import adopt_init_args
>> > >>> 16 from libtbx.utils import Sorry
>> > >>> ---> 17 import libtbx.load_env
>> > >>> 18 import math
>> > >>> 19 import sys, os
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e= in
>> <module>
>> > >>> 3 import libtbx.env_config
>> > >>> 4 import os
>> > >>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
>> > >>> 6 libtbx.env.set_os_environ_all_dist()
>> > >>> 7 libtbx.env.dispatcher_name =
>> os.environ.get("LIBTBX_DISPATCHER_NAME")
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e= in
>> unpickle()
>> > >>> 2603
>> > >>> 2604 def unpickle():
>> > >>> -> 2605 build_path = os.environ["LIBTBX_BUILD"]
>> > >>> 2606
>> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
>> > >>> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/https://urldefense.proofpoint.com/v2/url?u=http-3A__os.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=hA1zo5wap0c9wK3DrlWIKqYBIqqbfKXca5jQ9aX5pYU&e= in __getitem__(self, key)
>> > >>> 667 except KeyError:
>> > >>> 668 # raise KeyError with the original key value
>> > >>> --> 669 raise KeyError(key) from None
>> > >>> 670 return self.decodevalue(value)
>> > >>> 671
>> > >>>
>> > >>> KeyError: 'LIBTBX_BUILD'
>> > >>>
>> > >>>
>> > >>>
>> > >>>
>> ---------------------------------------------------------------------------
>> > >>> ArgumentError Traceback (most recent
>> call last)
>> > >>> <ipython-input-7-2acd3a9ce26a> in <module>
>> > >>> 26 return
>> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar
>> > >>> 27
>> > >>> ---> 28
>> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar=initializecrystal()
>> > >>>
>> > >>> <ipython-input-7-2acd3a9ce26a> in initializecrystal()
>> > >>> 11 uc = uctbx.unit_cell(unit_cell)
>> > >>> 12 wavelength = 1.54980
>> > >>> ---> 13 xtal_symm = crystal.symmetry(unit_cell=unit_cell,
>> > >>> space_group_symbol="P 43 21 2")
>> > >>> 14
>> > >>> 15 ms =
>> > >>> miller.build_set(crystal_symmetry=xtal_symm,anomalous_flag=True,
>> > >>> d_min=1.61)
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/crystal/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
>> > >>> __init__(self, unit_cell, space_group_symbol, space_group_info,
>> > >>> space_group, correct_rhombohedral_setting_if_necessary,
>> > >>> assert_is_compatible_unit_cell,
>> raise_sorry_if_incompatible_unit_cell,
>> > >>> force_compatible_unit_cell)
>> > >>> 74 if (space_group_symbol is not None):
>> > >>> 75 self._space_group_info = sgtbx.space_group_info(
>> > >>> ---> 76 symbol=space_group_symbol)
>> > >>> 77 elif (space_group is not None):
>> > >>> 78 if (isinstance(space_group, sgtbx.space_group)):
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/sgtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
>> > >>> __init__(self, symbol, table_id, group, number, space_group_t_den)
>> > >>> 100 assert group is None
>> > >>> 101 if (table_id is None):
>> > >>> --> 102 symbols = space_group_symbols(symbol)
>> > >>> 103 else:
>> > >>> 104 if (isinstance(symbol, int)): symbol = str(symbol)
>> > >>>
>> > >>> ArgumentError: Python argument types in
>> > >>> space_group_symbols.__init__(space_group_symbols, str)
>> > >>> did not match C++ signature:
>> > >>> __init__(_object*, int space_group_number)
>> > >>> __init__(_object*, int space_group_number,
>> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> > >>> std::allocator<char> > extension='')
>> > >>> __init__(_object*, int space_group_number,
>> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> > >>> std::allocator<char> > extension='', std::__cxx11::basic_string<char,
>> > >>> std::char_traits<char>, std::allocator<char> > table_id='')
>> > >>> __init__(_object*, std::__cxx11::basic_string<char,
>> > >>> std::char_traits<char>, std::allocator<char> > symbol)
>> > >>> __init__(_object*, std::__cxx11::basic_string<char,
>> > >>> std::char_traits<char>, std::allocator<char> > symbol,
>> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> > >>> std::allocator<char> > table_id='')
>> > >>>
>> > >>>
>> > >>> When I tried to set LIBTBX_BUILD to /home/gergely/anaconda3 (this is
>> > >>> sys.prefix on my system), I got other problems when importing. Can
>> > >>> LIBTBX_BUILD be set in the conda package?
>> > >>>
>> > >>>
>> > >>>
>> > >>>
>> ---------------------------------------------------------------------------
>> > >>> FileNotFoundError Traceback (most recent
>> call last)
>> > >>> <ipython-input-1-7e2b144826cc> in <module>
>> > >>> 26 from cctbx import sgtbx
>> > >>> 27 #from cctbx import miller
>> > >>> ---> 28 from iotbx import reflection_file_reader, mtz
>> > >>> 29 sns.set_context("poster")
>> > >>> 30 plt.rcParams.update({'figure.autolayout': True})
>> > >>>
>> > >>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__reflection-5Ffile-5Freader.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=U5BvLmuCgufvN_LRxQw9n78p33jNaRrXVbH1BRSXgxg&e=
>> > >>> in <module>
>> > >>> 53
>> > >>> 54 from __future__ import absolute_import, division,
>> print_function
>> > >>> ---> 55 from iotbx import mtz
>> > >>> 56 from iotbx.scalepack import merge as scalepack_merge
>> > >>> 57 from iotbx.scalepack import no_merge_original_index as
>> > >>> scalepack_no_merge
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
>> <module>
>> > >>> 9 import iotbx_mtz_ext as ext
>> > >>> 10
>> > >>> ---> 11 from iotbx.mtz import extract_from_symmetry_lib
>> > >>> 12 from cctbx import xray
>> > >>> 13 import cctbx.xray.observation_types
>> > >>>
>> > >>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__extract-5Ffrom-5Fsymmetry-5Flib.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=k3WR6VZd4-PDULPXl4O0Vwz9q3LCaocUUhK_ehTn9UE&e=
>> > >>> in <module>
>> > >>> 1 from __future__ import absolute_import, division,
>> print_function
>> > >>> 2 from cctbx import sgtbx
>> > >>> ----> 3 import libtbx.load_env
>> > >>> 4 import os.path as op
>> > >>> 5 from six.moves import range
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e= in
>> <module>
>> > >>> 3 import libtbx.env_config
>> > >>> 4 import os
>> > >>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
>> > >>> 6 libtbx.env.set_os_environ_all_dist()
>> > >>> 7 libtbx.env.dispatcher_name =
>> os.environ.get("LIBTBX_DISPATCHER_NAME")
>> > >>>
>> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e= in
>> unpickle()
>> > >>> 2605 build_path = os.environ["LIBTBX_BUILD"]
>> > >>> 2606
>> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
>> > >>> -> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
>> > >>> 2608 env = pickle.load(libtbx_env)
>> > >>> 2609 if (env.python_version_major_minor !=
>> sys.version_info[:2]):
>> > >>>
>> > >>> FileNotFoundError: [Errno 2] No such file or directory:
>> > >>> '/home/gergely/anaconda3/libtbx_env'
>> > >>>
>> > >>> On Wed, Dec 18, 2019 at 9:10 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> > >>> >
>> > >>> > Hi Gergely,
>> > >>> >
>> > >>> > I've uploaded linux packages to a new channel, cctbx-dev, and you
>> can install it with
>> > >>> >
>> > >>> > conda install -c cctbx-dev cctbx
>> > >>> >
>> > >>> > in your current environment. You should set your ~/.condarc file
>> to pull the other dependencies from the conda-forge channel first, so
>> put
>> conda-forge above cctbx. Mine looks like
>> > >>> >
>> > >>> > channels:
>> > >>> > - conda-forge
>> > >>> > - defaults
>> > >>> > - cctbx
>> > >>> >
>> > >>> > Do you need dxtbx for your scripts? This package does not build
>> that part. I think the plan is to build a separate conda package for
>> dxtbx
>> so that it can be updated more frequently. I can rebuild the packages
>> to
>> include it for testing, but the one being submitted to conda-forge
>> will not
>> have it.
>> > >>> >
>> > >>> > Also, your error message is probably due to version of HDF5 that
>> the development build installs. The
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c…
>> script will install
>> 1.10.4, but your other dependency is looking for 1.10.5. Installing
>> this
>> cctbx conda package should install 1.10.5, which should fix the issue.
>> Also, I'm updating those environments and 1.10.5 will be the new
>> default
>> version.
>> > >>> >
>> > >>> > Lastly, the dispatchers will not work in these packages because
>> the old paths during the build process are still in them and many of
>> them
>> expect some additional information that has not been updated in the
>> packages yet. I'm in the process of doing that and will update the
>> cctbx-dev channel when that's done. However, by starting python, you
>> can
>> import cctbx modules. So you can run commands like
>> > >>> >
>> > >>> > from scitbx.array_family import flex
>> > >>> > a = flex.random_double(1000000)
>> > >>> > b = flex.min_max_mean_double(a)
>> > >>> > b.min
>> > >>> > b.max
>> > >>> > b.mean
>> > >>> >
>> > >>> > Thanks!
>> > >>> >
>> > >>> > --
>> > >>> > Billy K. Poon
>> > >>> > Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> > >>> > Lawrence Berkeley National Laboratory
>> > >>> > 1 Cyclotron Road, M/S 33R0345
>> > >>> > Berkeley, CA 94720
>> > >>> > Tel: (510) 486-5709
>> > >>> > Fax: (510) 486-5909
>> > >>> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >>> >
>> > >>> >
>> > >>> > On Tue, Dec 17, 2019 at 5:39 AM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> > >>> >>
>> > >>> >> Dear Billy,
>> > >>> >>
>> > >>> >> Thank you for the detailed explanation, I look forward to do
>> further
>> > >>> >> testing! I aim to pool all modules under the same environment, if
>> > >>> >> there are conflicts then I just try to reshuffle the order of
>> imports.
>> > >>> >> So far this did not cause problems for me even when I was using
>> system
>> > >>> >> python, but of course it is not the most prudent thing to do. With
>> > >>> >> anaconda everything is much more standardized and isolated
>> already and
>> > >>> >> without being superuser I can have my familiar environment at any
>> > >>> >> synchrotron based cluster. It is great that cctbx will be an
>> integral
>> > >>> >> part of this ecosystem and this was also the last thing holding me
>> > >>> >> back from adopting python3. About hdf5, pymc3 requires it and
>> > >>> >> importing causes a kernel restart with the following error
>> messages,
>> > >>> >> curiously if I import h5py first this can be avoided.
>> > >>> >>
>> > >>> >> Best wishes,
>> > >>> >>
>> > >>> >> Gergely
>> > >>> >>
>> > >>> >> import pymc3 as pm
>> > >>> >>
>> > >>> >> Warning! ***HDF5 library version mismatched error***
>> > >>> >> The HDF5 header files used to compile this application do not
>> match
>> > >>> >> the version used by the HDF5 library to which this application is
>> linked.
>> > >>> >> Data corruption or segmentation faults may occur if the
>> application continues.
>> > >>> >> This can happen when an application was compiled by one version
>> of HDF5 but
>> > >>> >> linked with a different version of static or shared HDF5 library.
>> > >>> >> You should recompile the application or check your shared library
>> related
>> > >>> >> settings such as 'LD_LIBRARY_PATH'.
>> > >>> >> You can, at your own risk, disable this warning by setting the
>> environment
>> > >>> >> variable 'HDF5_DISABLE_VERSION_CHECK' to a value of '1'.
>> > >>> >> Setting it to 2 or higher will suppress the warning messages
>> totally.
>> > >>> >> Headers are 1.10.4, library is 1.10.5
>> > >>> >> SUMMARY OF THE HDF5 CONFIGURATION
>> > >>> >> =================================
>> > >>> >>
>> > >>> >> General Information:
>> > >>> >> -------------------
>> > >>> >> HDF5 Version: 1.10.5
>> > >>> >> Configured on: Tue Oct 22 12:02:13 UTC 2019
>> > >>> >> Configured by: conda@16247e67ecd5
>> > >>> >> Host system: x86_64-conda_cos6-linux-gnu
>> > >>> >> Uname information: Linux 16247e67ecd5
>> 4.15.0-1059-azure
>> > >>> >> #64-Ubuntu SMP Fri Sep 13 17:02:44 UTC 2019 x86_64 x86_64 x86_64
>> > >>> >> GNU/Linux
>> > >>> >> Byte sex: little-endian
>> > >>> >> Installation point: /home/gergely/anaconda3
>> > >>> >>
>> > >>> >> Compiling Options:
>> > >>> >> ------------------
>> > >>> >> Build Mode: production
>> > >>> >> Debugging Symbols: no
>> > >>> >> Asserts: no
>> > >>> >> Profiling: no
>> > >>> >> Optimization Level: high
>> > >>> >>
>> > >>> >> Linking Options:
>> > >>> >> ----------------
>> > >>> >> Libraries: static, shared
>> > >>> >> Statically Linked Executables:
>> > >>> >> LDFLAGS: -Wl,-O2 -Wl,--sort-common
>> > >>> >> -Wl,--as-needed -Wl,-z,relro -Wl,-z,now -Wl,--disable-new-dtags
>> > >>> >> -Wl,--gc-sections -Wl,-rpath,/home/gergely/anaconda3/lib
>> > >>> >> -Wl,-rpath-link,/home/gergely/anaconda3/lib
>> > >>> >> -L/home/gergely/anaconda3/lib
>> > >>> >> H5_LDFLAGS:
>> > >>> >> AM_LDFLAGS: -L/home/gergely/anaconda3/lib
>> > >>> >> Extra libraries: -lrt -lpthread -lz -ldl -lm
>> > >>> >> Archiver:
>> > >>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ar
>> > >>> >> AR_FLAGS: cr
>> > >>> >> Ranlib:
>> > >>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ranlib
>> > >>> >>
>> > >>> >> Languages:
>> > >>> >> ----------
>> > >>> >> C: yes
>> > >>> >> C Compiler:
>> > >>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-cc
>> > >>> >> CPPFLAGS: -DNDEBUG -D_FORTIFY_SOURCE=2 -O2
>> > >>> >> -I/home/gergely/anaconda3/include
>> > >>> >> H5_CPPFLAGS: -D_GNU_SOURCE
>> > >>> >> -D_POSIX_C_SOURCE=200809L -DNDEBUG -UH5_DEBUG_API
>> > >>> >> AM_CPPFLAGS:
>> -I/home/gergely/anaconda3/include
>> > >>> >> C Flags: -march=nocona -mtune=haswell
>> > >>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
>> > >>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
>> > >>> >>
>> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
>> > >>> >>
>> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
>> > >>> >> H5 C Flags: -std=c99 -pedantic -Wall
>> -Wextra
>> > >>> >> -Wbad-function-cast -Wc++-compat -Wcast-align -Wcast-qual
>> -Wconversion
>> > >>> >> -Wdeclaration-after-statement -Wdisabled-optimization
>> -Wfloat-equal
>> > >>> >> -Wformat=2 -Winit-self -Winvalid-pch -Wmissing-declarations
>> > >>> >> -Wmissing-include-dirs -Wmissing-prototypes -Wnested-externs
>> > >>> >> -Wold-style-definition -Wpacked -Wpointer-arith -Wredundant-decls
>> > >>> >> -Wshadow -Wstrict-prototypes -Wswitch-default -Wswitch-enum
>> -Wundef
>> > >>> >> -Wunused-macros -Wunsafe-loop-optimizations -Wwrite-strings
>> > >>> >> -finline-functions -s -Wno-inline -Wno-aggregate-return
>> > >>> >> -Wno-missing-format-attribute -Wno-missing-noreturn -O
>> > >>> >> AM C Flags:
>> > >>> >> Shared C Library: yes
>> > >>> >> Static C Library: yes
>> > >>> >>
>> > >>> >>
>> > >>> >> Fortran: yes
>> > >>> >> Fortran Compiler:
>> > >>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-gfortran
>> > >>> >> Fortran Flags:
>> > >>> >> H5 Fortran Flags: -pedantic -Wall -Wextra
>> -Wunderflow
>> > >>> >> -Wimplicit-interface -Wsurprising -Wno-c-binding-type -s -O2
>> > >>> >> AM Fortran Flags:
>> > >>> >> Shared Fortran Library: yes
>> > >>> >> Static Fortran Library: yes
>> > >>> >>
>> > >>> >> C++: yes
>> > >>> >> C++ Compiler:
>> > >>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-c++
>> > >>> >> C++ Flags: -fvisibility-inlines-hidden
>> > >>> >> -std=c++17 -fmessage-length=0 -march=nocona -mtune=haswell
>> > >>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
>> > >>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
>> > >>> >>
>> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
>> > >>> >>
>> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
>> > >>> >> H5 C++ Flags: -pedantic -Wall -W -Wundef
>> -Wshadow
>> > >>> >> -Wpointer-arith -Wcast-qual -Wcast-align -Wwrite-strings
>> -Wconversion
>> > >>> >> -Wredundant-decls -Winline -Wsign-promo -Woverloaded-virtual
>> > >>> >> -Wold-style-cast -Weffc++ -Wreorder -Wnon-virtual-dtor
>> > >>> >> -Wctor-dtor-privacy -Wabi -finline-functions -s -O
>> > >>> >> AM C++ Flags:
>> > >>> >> Shared C++ Library: yes
>> > >>> >> Static C++ Library: yes
>> > >>> >>
>> > >>> >> Java: no
>> > >>> >>
>> > >>> >>
>> > >>> >> Features:
>> > >>> >> ---------
>> > >>> >> Parallel HDF5: no
>> > >>> >> Parallel Filtered Dataset Writes: no
>> > >>> >> Large Parallel I/O: no
>> > >>> >> High-level library: yes
>> > >>> >> Threadsafety: yes
>> > >>> >> Default API mapping: v110
>> > >>> >> With deprecated public symbols: yes
>> > >>> >> I/O filters (external): deflate(zlib)
>> > >>> >> MPE: no
>> > >>> >> Direct VFD: no
>> > >>> >> dmalloc: no
>> > >>> >> Packages w/ extra debug output: none
>> > >>> >> API tracing: no
>> > >>> >> Using memory checker: yes
>> > >>> >> Memory allocation sanity checks: no
>> > >>> >> Function stack tracing: no
>> > >>> >> Strict file format checks: no
>> > >>> >> Optimization instrumentation: no
>> > >>> >>
>> > >>> >> On Tue, Dec 17, 2019 at 8:35 AM Billy Poon <BKPoon(a)lbl.gov>
>> wrote:
>> > >>> >> >
>> > >>> >> > Hi Gergely,
>> > >>> >> >
>> > >>> >> > Let me build the test package tomorrow. All the gritty details
>> for building with conda is being finalized and the official
>> documentation
>> will be updated to describe the steps. It would be too confusing to
>> keep
>> changing the documentation as the process evolves. You do have the
>> general
>> process, though, which is summarized as follows.
>> > >>> >> >
>> > >>> >> > 1) Installing dependencies. The cctbx_dependencies metapackage
>> was an initial approach for managing the CCTBX dependencies, but after
>> contacting the conda-forge folks, they recommended using the
>> --only-deps
>> flag. So when the CCTBX conda package is available, you'll be able to
>> get a
>> set of dependencies with,
>> > >>> >> >
>> > >>> >> > conda install -c conda-forge --only-deps cctbx
>> > >>> >> >
>> > >>> >> > By default, the https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file will automatically install a
>> set of dependencies in the "conda_base" directory (and a conda
>> installation
>> if one is not found). It just uses standard conda environment files
>> located
>> in libtbx/auto_build/conda_envs, so you do not need to install
>> cctbx_dependencies as a separate step. The environment files avoid
>> channel
>> issues by explicitly defining the channel to pull the packages from
>> and the
>> cctbx channel just stores copies of packages from conda-forge. There
>> were
>> issues earlier where the conda-forge packages would sometimes be moved
>> to a
>> different label. The --use-conda flag also accepts a path to
>> $CONDA_PREFIX
>> if you want to use a specific environment for testing.
>> > >>> >> >
>> > >>> >> > 2) Building. The https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file handles that with SCons.
>> > >>> >> >
>> > >>> >> > 3) Running. After building, there should be a https://urldefense.proofpoint.com/v2/url?u=http-3A__setpaths.sh&d=DwICAg&c=… (and
>> .csh) file that adds build/bin to your path. The build/bin directory
>> has
>> our dispatchers, which are just scripts that set up the environment
>> variables for you. This prevents other programs from loading our
>> libraries,
>> whose versions may conflict. You should see that there is a "python"
>> dispatcher, which is a convenience for developers. Otherwise, you can
>> use
>> libtbx.python, which will be able to import CCTBX modules.
>> > >>> >> >
>> > >>> >> > The running part is where the conda package for CCTBX will be
>> different than this build. Since our Python files and extensions
>> modules
>> will be in the "site-packages" directory for Python, the PYTHONPATH
>> variable will not be needed (and conda suggests that that variable not
>> be
>> set). The other CCTBX libraries will be in $CONDA_PREFIX/lib, so
>> LD_LIBRARY_PATH is not needed. In an active environment, PATH will
>> already
>> be modified. And then our LIBTBX_BUILD directory can be set to
>> sys.prefix.
>> > >>> >> >
>> > >>> >> > So with the conda package, you would only need to activate your
>> conda environment and CCTBX should integrate with other conda
>> packages.
>> What is the conflict with hdf5? That's something that should be fixed.
>> Thanks!
>> > >>> >> >
>> > >>> >> > --
>> > >>> >> > Billy K. Poon
>> > >>> >> > Research Scientist, Molecular Biophysics and Integrated
>> Bioimaging
>> > >>> >> > Lawrence Berkeley National Laboratory
>> > >>> >> > 1 Cyclotron Road, M/S 33R0345
>> > >>> >> > Berkeley, CA 94720
>> > >>> >> > Tel: (510) 486-5709
>> > >>> >> > Fax: (510) 486-5909
>> > >>> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >>> >> >
>> > >>> >> >
>> > >>> >> > On Mon, Dec 16, 2019 at 2:53 AM Gergely Katona <
>> gkatona(a)gmail.com> wrote:
>> > >>> >> >>
>> > >>> >> >> Dear Billy,
>> > >>> >> >>
>> > >>> >> >> Thank you for this update and for your efforts! I found a
>> solution and
>> > >>> >> >> indeed most things already work in anaconda3. The steps I took
>> (even
>> > >>> >> >> if these instructions will have short expiry date):
>> > >>> >> >>
>> > >>> >> >> Modified .condarc with:
>> > >>> >> >> channels:
>> > >>> >> >> - cctbx
>> > >>> >> >> - conda-forge
>> > >>> >> >> - defaults
>> > >>> >> >>
>> > >>> >> >> run
>> > >>> >> >> conda conda install cctbx_dependencies python=3.6
>> > >>> >> >>
>> > >>> >> >> I expect this will work without python=3.6 in the near future.
>> > >>> >> >>
>> > >>> >> >> Then compiling cctbx with anaconda3 python went without any
>> problem
>> > >>> >> >> when using these flags:
>> > >>> >> >> python https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… --use-conda --python3 --nproc=12
>> > >>> >> >>
>> > >>> >> >> Then I probably did the unorthodox thing and sourced these
>> directories:
>> > >>> >> >>
>> > >>> >> >> setenv LIBTBX_BUILD /home/gergely/cctbx/build
>> > >>> >> >> setenv PATH ${PATH}:/home/gergely/cctbx/build/bin
>> > >>> >> >> setenv PYTHONPATH
>> > >>> >> >>
>> /home/gergely/cctbx/modules/cctbx_project:/home/gergely/cctbx/modules:/home/gergely/cctbx/modules/cctbx_project/boost_adaptbx:/home/gergely/cctbx/build/lib:/home/gergely/cctbx/conda_base/lib/python3.6/site-packages:$PYTHONPATH
>> > >>> >> >> setenv LD_LIBRARY_PATH
>> > >>> >> >>
>> /home/gergely/cctbx/conda_base/lib:/home/gergely/cctbx/build/lib:$LD_LIBRARY_PATH
>> > >>> >> >>
>> > >>> >> >> There is probably a better way to put this into conda
>> environment.
>> > >>> >> >> With these steps I could run one of my scripts depending on
>> cctbx. The
>> > >>> >> >> only problem I found is that hdf5 library had conflict with
>> another
>> > >>> >> >> package in conda, but I does not find this as a showstopper.
>> > >>> >> >>
>> > >>> >> >> Best wishes,
>> > >>> >> >>
>> > >>> >> >> Gergely
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >> On Fri, Dec 13, 2019 at 7:23 PM Billy Poon <BKPoon(a)lbl.gov>
>> wrote:
>> > >>> >> >> >
>> > >>> >> >> > Hi Gergely,
>> > >>> >> >> >
>> > >>> >> >> > It's still a work in progress. I'm sorting out some Windows
>> issues right now. I can probably build a test package on a separate
>> channel
>> for people that want to test it (let's say next week?). I'll provide
>> instructions, but basically, the test conda package will be in its own
>> separate channel and the dependencies will be pulled from the
>> conda-forge
>> channel. I want most things to be working correctly on Python 2.7,
>> 3.6,
>> 3.7, and 3.8 on all 3 platforms.
>> > >>> >> >> >
>> > >>> >> >> > Thanks!
>> > >>> >> >> >
>> > >>> >> >> > --
>> > >>> >> >> > Billy K. Poon
>> > >>> >> >> > Research Scientist, Molecular Biophysics and Integrated
>> Bioimaging
>> > >>> >> >> > Lawrence Berkeley National Laboratory
>> > >>> >> >> > 1 Cyclotron Road, M/S 33R0345
>> > >>> >> >> > Berkeley, CA 94720
>> > >>> >> >> > Tel: (510) 486-5709
>> > >>> >> >> > Fax: (510) 486-5909
>> > >>> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >>> >> >> >
>> > >>> >> >> >
>> > >>> >> >> > On Fri, Dec 13, 2019 at 5:44 AM Gergely Katona <
>> gkatona(a)gmail.com> wrote:
>> > >>> >> >> >>
>> > >>> >> >> >> Dear Billy,
>> > >>> >> >> >>
>> > >>> >> >> >> This sounds very promising and exciting. I am not sure if
>> cctbx is
>> > >>> >> >> >> already functional as a conda package in anaconda3 (Linux)
>> or this is
>> > >>> >> >> >> still work in progress. My technical expertise does not
>> allow me to
>> > >>> >> >> >> tell the difference. What I tried:
>> > >>> >> >> >>
>> > >>> >> >> >> Fresh install of anaconda3. Adding - cctbx and -
>> conda-forge to
>> > >>> >> >> >> .condarc . Installing pyside2 with conda. Running conda
>> install
>> > >>> >> >> >> conda_dependencies . I get a lot package version conflict,
>> and I
>> > >>> >> >> >> cannot import cctbx or iotbx to anaconda python. Am I
>> following the
>> > >>> >> >> >> right instructions? Or it is too early to expect that cctbx
>> works when
>> > >>> >> >> >> installed through conda?
>> > >>> >> >> >>
>> > >>> >> >> >> Best wishes,
>> > >>> >> >> >>
>> > >>> >> >> >> Gergely
>> > >>> >> >> >>
>> > >>> >> >> >> On Wed, Nov 27, 2019 at 3:56 PM Billy Poon <BKPoon(a)lbl.gov>
>> wrote:
>> > >>> >> >> >> >
>> > >>> >> >> >> > Hi all,
>> > >>> >> >> >> >
>> > >>> >> >> >> > For a brief update, I have submitted a recipe for
>> cctbxlite to conda-forge (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_conda-2Dfor…
>> ) and support for
>> Python 3.7 and 3.8 is being added (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx…
>> ). With some fixes for
>> Windows
>> (https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx…
>> ), all platforms
>> (macOS, linux, and Windows) can build for Python 2.7, 3.6, 3.7, and
>> 3.8.
>> Some additional changes will be needed to get Windows to work with
>> Python 3
>> and for tests to pass with Boost 1.70.0. That will enable the
>> conda-forge
>> recipe to build for all platforms and for all supported versions of
>> Python.
>> > >>> >> >> >> >
>> > >>> >> >> >> > Currently, the conda-forge recipe will install into the
>> conda python and cctbx imports can be done without sourcing the
>> environment
>> scripts. It looks like a lot of the environment variables being set in
>> the
>> dispatchers can be removed since the Python files and C++ extensions
>> are in
>> the right places. I'll update the libtbx_env file so that commands
>> that
>> load the environment can work correctly.
>> > >>> >> >> >> >
>> > >>> >> >> >> > --
>> > >>> >> >> >> > Billy K. Poon
>> > >>> >> >> >> > Research Scientist, Molecular Biophysics and Integrated
>> Bioimaging
>> > >>> >> >> >> > Lawrence Berkeley National Laboratory
>> > >>> >> >> >> > 1 Cyclotron Road, M/S 33R0345
>> > >>> >> >> >> > Berkeley, CA 94720
>> > >>> >> >> >> > Tel: (510) 486-5709
>> > >>> >> >> >> > Fax: (510) 486-5909
>> > >>> >> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> > >>> >> >> >> >
>> > >>> >> >> >> >
>> > >>> >> >> >> > On Sun, Aug 25, 2019 at 2:33 PM Tristan Croll <
>> tic20(a)cam.ac.uk> wrote:
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> Hi Luc,
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> That sounds promising. From there, I?d need to work out
>> how to make a fully-packaged installer (basically a modified wheel
>> file)
>> for the ChimeraX ToolShed - the aim is for the end user to not have to
>> worry about any of this. That adds a couple of complications - e.g.
>> $LIBTBX_BUILD would need to be set dynamically before first import -
>> but
>> doesn?t seem insurmountable.
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> Thanks,
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> Tristan
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> Tristan Croll
>> > >>> >> >> >> >> Research Fellow
>> > >>> >> >> >> >> Cambridge Institute for Medical Research
>> > >>> >> >> >> >> University of Cambridge CB2 0XY
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> > On 25 Aug 2019, at 18:31, Luc Bourhis <
>> luc_j_bourhis(a)mac.com> wrote:
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> > Hi Tristan,
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> > cctbx could be built to use your ChimeraX python, now
>> that cctbx is moving to Python 3. The option ?with-python is there for
>> that
>> with the bootstrap script. The specific environment setup boil down to
>> setting two environment variable LIBTBX_BUILD and either
>> LD_LIBRARY_PATH on
>> Linux, PATH on Win32, or DYLIB_LIBRARY_PATH on MacOS. If you work
>> within a
>> framework such as ChimeraX, that should not be difficult to ensure
>> those
>> two variables are set.
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> > Best wishes,
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> > Luc
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> >> On 23 Aug 2019, at 19:02, Tristan Croll <
>> tic20(a)cam.ac.uk> wrote:
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> To add my two cents on this: probably the second-most
>> common question I've had about ISOLDE's implementation is, "why didn't
>> you
>> use CCTBX?". The honest answer to that is, "I didn't know how."
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> Still don't, really - although the current
>> developments are rather promising. The problem I've faced is that
>> CCTBX was
>> designed as its own self-contained Python (2.7, until very recently)
>> environment, with its own interpreter and a lot of very specific
>> environment setup. Meanwhile I'm developing ISOLDE in ChimeraX, which
>> is
>> *also* its own self-contained Python (3.7) environment. To plug one
>> into
>> the other in that form... well, I don't think I'm a good enough
>> programmer
>> to really know where to start.
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> The move to Conda and a more modular CCTBX
>> architecture should make a lot more possible in that direction. Pip
>> would
>> be even better for me personally (ChimeraX can install directly from
>> the
>> PyPI, but doesn't interact with Conda) - but I understand pretty well
>> the
>> substantial challenge that would amount to (not least being that the
>> PyPI
>> imposes a limit - around 100MB from memory? - on the size of an
>> individual
>> package).
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> Best regards,
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> Tristan
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >>> On 2019-08-23 09:28, Luc Bourhis wrote:
>> > >>> >> >> >> >> >>> Hi Graeme,
>> > >>> >> >> >> >> >>> Yes, I know. But ?black" is a program doing a very
>> particular task
>> > >>> >> >> >> >> >>> (code formatting from the top of my head). Requiring
>> to use a wrapper
>> > >>> >> >> >> >> >>> for python itself is another level. But ok, I think
>> I am mellowing to
>> > >>> >> >> >> >> >>> the idea after all! Talking with people around me,
>> and extrapolating,
>> > >>> >> >> >> >> >>> I would bet that, right now, a great majority of
>> people interested by
>> > >>> >> >> >> >> >>> cctbx in pip have already used the cctbx, so they
>> know about the
>> > >>> >> >> >> >> >>> Python wrapper, and they would not be too sanguine
>> about that. My
>> > >>> >> >> >> >> >>> concern is for the future, when pip will be the
>> first time some people
>> > >>> >> >> >> >> >>> use cctbx. Big fat warning notices on PyPI page and
>> a better error
>> > >>> >> >> >> >> >>> message when cctbx fails because LIBTBX_BUILD is not
>> set would be
>> > >>> >> >> >> >> >>> needed but that could be all right.
>> > >>> >> >> >> >> >>> If we do a pip installer, we should aim at a minimal
>> install: cctbx,
>> > >>> >> >> >> >> >>> iotbx and their dependencies, and that?s it.
>> > >>> >> >> >> >> >>> Best wishes,
>> > >>> >> >> >> >> >>> Luc
>> > >>> >> >> >> >> >>>> On 23 Aug 2019, at 07:17,
>> Graeme.Winter(a)Diamond.ac.uk <Graeme.Winter(a)diamond.ac.uk> wrote:
>> > >>> >> >> >> >> >>>> Without discussing the merits of this or whether we
>> _choose_ to make the move to supporting PIP, I am certain it would be
>> _possible_ - many other packages make dispatcher scripts when you pip
>> install them e.g.
>> > >>> >> >> >> >> >>>> Silver-Surfer rescale_f2 :) $ which black; cat
>> $(which black)
>> > >>> >> >> >> >> >>>>
>> /Library/Frameworks/Python.framework/Versions/3.6/bin/black
>> > >>> >> >> >> >> >>>>
>> #!/Library/Frameworks/Python.framework/Versions/3.6/bin/python3.6
>> > >>> >> >> >> >> >>>> # -*- coding: utf-8 -*-
>> > >>> >> >> >> >> >>>> import re
>> > >>> >> >> >> >> >>>> import sys
>> > >>> >> >> >> >> >>>> from black import main
>> > >>> >> >> >> >> >>>> if __name__ == '__main__':
>> > >>> >> >> >> >> >>>> sys.argv[0] = re.sub(r'(-script\.pyw?|\.exe)?$',
>> '', sys.argv[0])
>> > >>> >> >> >> >> >>>> sys.exit(main())
>> > >>> >> >> >> >> >>>> So we _could_ work around the absence of
>> LIBTBX_BUILD etc. in the system. Whether or not we elect to do the
>> work is
>> a different question, and it seems clear that here are very mixed
>> opinions
>> on this.
>> > >>> >> >> >> >> >>>> Best wishes Graeme
>> > >>> >> >> >> >> >>>> On 23 Aug 2019, at 01:21, Luc Bourhis <
>> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
>> > >>> >> >> >> >> >>>> Hi,
>> > >>> >> >> >> >> >>>> Even if we managed to ship our the boost dynamic
>> libraries with pip, it would still not be pip-like, as we would still
>> need
>> our python wrappers to set LIBTBX_BUILD and LD_LIBRARY_PATH. Normal
>> pip
>> packages work with the standard python exe. LD_LIBRARY_PATH, we could
>> get
>> around that by changing the way we compile, using -Wl,-R, which is the
>> runtime equivalent of build time -L. That?s a significant change that
>> would
>> need to be tested. But there is no way around setting LIBTBX_BUILD
>> right
>> now. Leaving that to the user is horrible. Perhaps there is a way to
>> hack
>> libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&…
>> so that we can hardwire LIBTBX_BUILD in there when pip
>> installs?
>> > >>> >> >> >> >> >>>> Best wishes,
>> > >>> >> >> >> >> >>>> Luc
>> > >>> >> >> >> >> >>>> On 16 Aug 2019, at 22:47, Luc Bourhis <
>> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
>> > >>> >> >> >> >> >>>> Hi,
>> > >>> >> >> >> >> >>>> I did look into that many years ago, and even toyed
>> with building a pip installer. What stopped me is the exact conclusion
>> you
>> reached too: the user would not have the pip experience he expects.
>> You are
>> right that it is a lot of effort but is it worth it? Considering that
>> remark, I don?t think so. Now, Conda was created specifically to go
>> beyond
>> pip pure-python-only support. Since cctbx has garnered support for
>> Conda,
>> the best avenue imho is to go the extra length to have a package on
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__Anaconda.org&d=DwICAg&c…
>> <https://urldefense.proofpoint.com/v2/url?u=http-3A__anaconda.org_&d=DwICAg&…
>> >, and then to advertise it hard to
>> every potential user out there.
>> > >>> >> >> >> >> >>>> Best wishes,
>> > >>> >> >> >> >> >>>> Luc
>> > >>> >> >> >> >> >>>> On 16 Aug 2019, at 21:45, Aaron Brewster <
>> asbrewster(a)lbl.gov<mailto:[email protected]>> wrote:
>> > >>> >> >> >> >> >>>> Hi, to avoid clouding Dorothee's documentation
>> email thread, which I think is a highly useful enterprise, here's some
>> thoughts about putting cctbx into pip. Pip doesn't install non-python
>> dependencies well. I don't think boost is available as a package on
>> pip
>> (at least the package version we use). wxPython4 isn't portable
>> through
>> pip (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__wiki.wxpython.org_How-…
>> ).
>> MPI libraries are system dependent. If cctbx were a pure python
>> package,
>> pip would be fine, but cctbx is not.
>> > >>> >> >> >> >> >>>> All that said, we could build a manylinux1 version
>> of cctbx and upload it to PyPi (I'm just learning about this). For a
>> pip
>> package to be portable (which is a requirement for cctbx), it needs to
>> conform to PEP513, the manylinux1 standard (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep…
>> ). For example, numpy is built
>> according to this standard (see
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__pypi.org_project_numpy…
>> ,
>> where you'll see the manylinux1 wheel). Note, the manylinux1 standard
>> is
>> built with Centos 5.11 which we no longer support.
>> > >>> >> >> >> >> >>>> There is also a manylinux2010 standard, which is
>> based on Centos 6
>> (https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep…
>> ). This is
>> likely a more attainable target (note though by default C++11 is not
>> supported on Centos 6).
>> > >>> >> >> >> >> >>>> If we built a manylinuxX version of cctbx and
>> uploaded it to PyPi, the user would need all the non-python
>> dependencies.
>> There's no way to specify these in pip. For example, cctbx requires
>> boost
>> 1.63 or better. The user will need to have it in a place their python
>> can
>> find it, or we could package it ourselves and supply it, similar to
>> how the
>> pip h5py package now comes with an hd5f library, or how the pip numpy
>> package includes an openblas library. We'd have to do the same for
>> any
>> packages we depend on that aren't on pip using the manylinux
>> standards,
>> such as wxPython4.
>> > >>> >> >> >> >> >>>> Further, we need to think about how dials and other
>> cctbx-based packages interact. If pip install cctbx is set up, how
>> does
>> pip install dials work, such that any dials shared libraries can find
>> the
>> cctbx libraries? Can shared libraries from one pip package link
>> against
>> libraries in another pip package? Would each package need to supply
>> its
>> own boost? Possibly this is well understood in the pip field, but not
>> by
>> me :)
>> > >>> >> >> >> >> >>>> Finally, there's the option of providing a source
>> pip package. This would require the full compiler toolchain for any
>> given
>> platform (macOS, linux, windows). These are likely available for
>> developers, but not for general users.
>> > >>> >> >> >> >> >>>> Anyway, these are some of the obstacles. Not
>> saying it isn't possible, it's just a lot of effort.
>> > >>> >> >> >> >> >>>> Thanks,
>> > >>> >> >> >> >> >>>> -Aaron
>> > >>> >> >> >> >> >>>> _______________________________________________
>> > >>> >> >> >> >> >>>> cctbxbb mailing list
>> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >>>> _______________________________________________
>> > >>> >> >> >> >> >>>> cctbxbb mailing list
>> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >>>> _______________________________________________
>> > >>> >> >> >> >> >>>> cctbxbb mailing list
>> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >>>> --
>> > >>> >> >> >> >> >>>> This e-mail and any attachments may contain
>> confidential, copyright and or privileged material, and are for the
>> use of
>> the intended addressee only. If you are not the intended addressee or
>> an
>> authorised recipient of the addressee please notify us of receipt by
>> returning the e-mail and do not use, copy, retain, distribute or
>> disclose
>> the information in or attached to the e-mail.
>> > >>> >> >> >> >> >>>> Any opinions expressed within this e-mail are those
>> of the individual and not necessarily of Diamond Light Source Ltd.
>> > >>> >> >> >> >> >>>> Diamond Light Source Ltd. cannot guarantee that
>> this e-mail or any attachments are free from viruses and we cannot
>> accept
>> liability for any damage which you may sustain as a result of software
>> viruses which may be transmitted in or with the message.
>> > >>> >> >> >> >> >>>> Diamond Light Source Limited (company no. 4375679).
>> Registered in England and Wales with its registered office at Diamond
>> House, Harwell Science and Innovation Campus, Didcot, Oxfordshire,
>> OX11
>> 0DE, United Kingdom
>> > >>> >> >> >> >> >>>> _______________________________________________
>> > >>> >> >> >> >> >>>> cctbxbb mailing list
>> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org
>> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >>> _______________________________________________
>> > >>> >> >> >> >> >>> cctbxbb mailing list
>> > >>> >> >> >> >> >>> cctbxbb(a)phenix-online.org
>> > >>> >> >> >> >> >>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >>
>> > >>> >> >> >> >> >> _______________________________________________
>> > >>> >> >> >> >> >> cctbxbb mailing list
>> > >>> >> >> >> >> >> cctbxbb(a)phenix-online.org
>> > >>> >> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> >
>> > >>> >> >> >> >> > _______________________________________________
>> > >>> >> >> >> >> > cctbxbb mailing list
>> > >>> >> >> >> >> > cctbxbb(a)phenix-online.org
>> > >>> >> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >>
>> > >>> >> >> >> >>
>> > >>> >> >> >> >> _______________________________________________
>> > >>> >> >> >> >> cctbxbb mailing list
>> > >>> >> >> >> >> cctbxbb(a)phenix-online.org
>> > >>> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >> >
>> > >>> >> >> >> > _______________________________________________
>> > >>> >> >> >> > cctbxbb mailing list
>> > >>> >> >> >> > cctbxbb(a)phenix-online.org
>> > >>> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >>
>> > >>> >> >> >>
>> > >>> >> >> >>
>> > >>> >> >> >> --
>> > >>> >> >> >> Gergely Katona, PhD
>> > >>> >> >> >> Associate Professor
>> > >>> >> >> >> Department of Chemistry and Molecular Biology, University
>> of Gothenburg
>> > >>> >> >> >> Box 462, 40530 G?teborg, Sweden
>> > >>> >> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax:
>> +46-31-786-3910
>> > >>> >> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> > >>> >> >> >>
>> > >>> >> >> >> _______________________________________________
>> > >>> >> >> >> cctbxbb mailing list
>> > >>> >> >> >> cctbxbb(a)phenix-online.org
>> > >>> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >> >
>> > >>> >> >> > _______________________________________________
>> > >>> >> >> > cctbxbb mailing list
>> > >>> >> >> > cctbxbb(a)phenix-online.org
>> > >>> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >>
>> > >>> >> >> --
>> > >>> >> >> Gergely Katona, PhD
>> > >>> >> >> Associate Professor
>> > >>> >> >> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> > >>> >> >> Box 462, 40530 G?teborg, Sweden
>> > >>> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax:
>> +46-31-786-3910
>> > >>> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> > >>> >> >>
>> > >>> >> >> _______________________________________________
>> > >>> >> >> cctbxbb mailing list
>> > >>> >> >> cctbxbb(a)phenix-online.org
>> > >>> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >> >
>> > >>> >> > _______________________________________________
>> > >>> >> > cctbxbb mailing list
>> > >>> >> > cctbxbb(a)phenix-online.org
>> > >>> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >>
>> > >>> >>
>> > >>> >>
>> > >>> >> --
>> > >>> >> Gergely Katona, PhD
>> > >>> >> Associate Professor
>> > >>> >> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> > >>> >> Box 462, 40530 G?teborg, Sweden
>> > >>> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> > >>> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> > >>> >>
>> > >>> >> _______________________________________________
>> > >>> >> cctbxbb mailing list
>> > >>> >> cctbxbb(a)phenix-online.org
>> > >>> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>> >
>> > >>> > _______________________________________________
>> > >>> > cctbxbb mailing list
>> > >>> > cctbxbb(a)phenix-online.org
>> > >>> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >>>
>> > >>>
>> > >>>
>> > >>> --
>> > >>> Gergely Katona, PhD
>> > >>> Associate Professor
>> > >>> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> > >>> Box 462, 40530 G?teborg, Sweden
>> > >>> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> > >>> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> > >>>
>> > >>> _______________________________________________
>> > >>> cctbxbb mailing list
>> > >>> cctbxbb(a)phenix-online.org
>> > >>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> > >
>> > > _______________________________________________
>> > > cctbxbb mailing list
>> > > cctbxbb(a)phenix-online.org
>> > > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >
>> >
>> >
>> > --
>> > Gergely Katona, Professor
>> > Department of Chemistry and Molecular Biology, University of Gothenburg
>> > Box 462, 40530 G?teborg, Sweden
>> > Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> > Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>>
>>
>>
>> --
>> Gergely Katona, Professor
>> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> Box 462, 40530 G?teborg, Sweden
>> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> Web:
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c…
>> , Email: gergely.katona(a)gu.se
>>
>> _______________________________________________
>> cctbxbb mailing list
>> cctbxbb(a)phenix-online.org
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>>
>
1
0

05 Jan '20
Hi Billy,
Gergely's post yesterday stimulated me to check my conda cctbx setup.
I had earlier reported success with conda cctbx for Python3.6, 3.7, and 3.8.
This morning I found in my path an earlier python3.6 build of cctbx that may
have given me false positives with my conda installs of cctbx.
After removing the old build of cctbx from my path, I modified my zshrc file
as Gergely suggested. I can confirm that results that Gergely reported yesterday.
I used a Mac OS X 10.15.2 with zsh as my shell and anaconda3 installed
as /opt/anaconda. I did my testing in a conda env named cctbx38.
I added 'export LIBTBX_BUILD=$CONDA_PREFIX' in my .zshrc file.
After sourcing my .zshrc file, 'echo $LIBTBX_BUILD' returns '/opt/anaconda/envs/cctbx38' as expected.
The toy script below prints the calculated Miller indices as a tuples in a terminal window.
It was run using 'python millerSet.py'.
Note that the printing of 1 million indices to a jupyter notebook cell is disappointingly slow!!
Reduce each unit cell dimension by two orders of magnitude before trying this at home!
The following code also worked with Python3.6 and Python3.7 in their corresponding cctbx36 and cctbx37 envs.
from cctbx import crystal
from cctbx import miller
ms = miller.build_set(
crystal_symmetry=crystal.symmetry(
space_group_symbol='P4',
unit_cell=(150.8,150.8,250.4,90.0,90.0,90.0)),
anomalous_flag=False,
d_min=1.4)
[print(hkl) for hkl in ms.indices()]
I used conda python3.8.0 built on November 22. Python3.8.1 does not seem to be
available yet from Anaconda.
Best regards,
Blaine
Blaine Mooers, Ph.D.
Associate Professor
Department of Biochemistry and Molecular Biology
College of Medicine
University of Oklahoma Health Sciences Center
S.L. Young Biomedical Research Center (BRC) Rm. 466
975 NE 10th Street, BRC 466
Oklahoma City, OK 73104-5419
________________________________________
From: cctbxbb-bounces(a)phenix-online.org [cctbxbb-bounces(a)phenix-online.org] on behalf of cctbxbb-request(a)phenix-online.org [cctbxbb-request(a)phenix-online.org]
Sent: Saturday, January 04, 2020 2:00 PM
To: cctbxbb(a)phenix-online.org
Subject: [EXTERNAL] cctbxbb Digest, Vol 130, Issue 2
Send cctbxbb mailing list submissions to
cctbxbb(a)phenix-online.org
To subscribe or unsubscribe via the World Wide Web, visit
https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
or, via email, send a message with subject or body 'help' to
cctbxbb-request(a)phenix-online.org
You can reach the person managing the list at
cctbxbb-owner(a)phenix-online.org
When replying, please edit your Subject line so it is more specific
than "Re: Contents of cctbxbb digest..."
Today's Topics:
1. Re: some thoughts on cctbx and pip (Billy Poon)
----------------------------------------------------------------------
Message: 1
Date: Fri, 3 Jan 2020 21:04:25 +0100
From: Billy Poon <BKPoon(a)lbl.gov>
To: cctbx mailing list <cctbxbb(a)phenix-online.org>
Subject: Re: [cctbxbb] some thoughts on cctbx and pip
Message-ID:
<CAHmYUcbWS7FXA6EPUx=AC2X6m6gPY=GqH-MwGD+uzpTaOKSyjQ(a)mail.gmail.com>
Content-Type: text/plain; charset="utf-8"
Hi Gergely,
Happy New Year!
Can you provide the output to "conda list" for each environment?
I suspect that the old version of cctbx might still be around. Is there a
file named PYTHON_VERSION_MAJOR_MINOR in "/home/gergely/anaconda3/lib"? If
so, delete that file. To make sure you are downloading a new copy of the
package, clear the cache where conda keeps copies of all the packages. To
do that, you can run "conda clean -y --all". You can remove the "-y" flag
if you want to see what will be deleted. The hash for the new linux package
should be h8b68381_0.
The last error looks like an incompatible version of boost or gcc library
was installed. The output from "conda list" should show the boost and
boost-cpp packages coming from conda-forge. I would avoid installing into
the root or base environment because that usually pulls from the default
channels. All the dependencies should be pulled from the conda-forge
channel.
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
On Fri, Jan 3, 2020 at 2:20 PM Gergely Katona <gkatona(a)gmail.com> wrote:
> I found some other errors when using the test environment.
>
>
> ---------------------------------------------------------------------------
> RuntimeError Traceback (most recent call last)
> <ipython-input-1-fe308b345b3f> in <module>
> 10 import scipy as sp
> 11 from scipy import linalg
> ---> 12 import iotbx.pdb
> 13 import cctbx
> 14 import pandas as pd
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
> in <module>
> 8
> 9 import iotbx.pdb.records
> ---> 10 import iotbx.pdb.hierarchy
> 11 from scitbx import matrix
> 12
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__hierarchy.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=QlonHINbJqyu1vTwlBJWKyChCMCCJxpIWIaT5_rrkLc&e=
> in <module>
> 14 from six.moves import cStringIO as StringIO
> 15 from iotbx.pdb import hy36encode, hy36decode
> ---> 16 import iotbx.cif.model
> 17 from cctbx import crystal
> 18 from libtbx import group_args
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/iotbx/cif/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
> in <module>
> 19
> 20 from cctbx.array_family import flex
> ---> 21 from cctbx import miller
> 22 from iotbx.cif import model, builders, geometry
> 23 from libtbx.containers import OrderedDict
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
> in <module>
> 11
> 12 from cctbx import crystal
> ---> 13 from cctbx import maptbx
> 14 from cctbx import sgtbx
> 15 from cctbx.sgtbx import lattice_symmetry
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/cctbx/maptbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e=
> in <module>
> 15 from libtbx import adopt_init_args
> 16 from libtbx.utils import Sorry
> ---> 17 import libtbx.load_env
> 18 import math
> 19 import sys, os
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e= in
> <module>
> 3 import libtbx.env_config
> 4 import os
> ----> 5 libtbx.env = libtbx.env_config.unpickle()
> 6 libtbx.env.set_os_environ_all_dist()
> 7 libtbx.env.dispatcher_name =
> os.environ.get("LIBTBX_DISPATCHER_NAME")
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e=
> in unpickle()
> 2736 env = pickle.load(libtbx_env)
> 2737 if (env.python_version_major_minor != sys.version_info[:2]):
> -> 2738 env.raise_python_version_incompatible()
> 2739 if (op.realpath(build_path) != op.realpath(abs(env.build_path))):
> 2740 env.build_path.reset(build_path)
>
> ~/anaconda3/envs/test/lib/python3.8/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e=
> in raise_python_version_incompatible(self, prev_pvmm)
> 469 if (prev_pvmm is None):
> 470 prev_pvmm = "%d.%d" % self.python_version_major_minor
> --> 471 raise RuntimeError("Python version incompatible with this
> build:\n"
> 472 + " Build directory: %s\n" %
> show_string(abs(self.build_path))
> 473 + " Python version used initially: %s\n" % prev_pvmm
>
> RuntimeError: Python version incompatible with this build:
> Build directory: "/home/gergely/anaconda3"
> Python version used initially: 3.6
> Python version in use now: 3.8
>
>
> Interestingly in the base environment all import worked, but I got an
> error at:
>
>
> ArgumentError Traceback (most recent call last)
> <ipython-input-4-5bc71c36e121> in <module>
> 33 atm_odd.set_b(0)
> 34
> ---> 35 odd.write_pdb_file("bdiff_in_even_000.pdb") #skriver ny pdb
> med dessa inkluderade
> 36 dfWBvals=pd.DataFrame(rows_list)
>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> write_pdb_file(self, file_name, open_append, crystal_symmetry,
> cryst1_z, write_scale_records, append_end, atom_hetatm, sigatm,
> anisou, siguij)
> 930 siguij=True):
> 931 if (crystal_symmetry is Auto):
> --> 932 crystal_symmetry = self.crystal_symmetry()
> 933 if (cryst1_z is Auto):
> 934 cryst1_z = self.extract_cryst1_z_columns()
>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> crystal_symmetry(self, crystal_symmetry, weak_symmetry)
> 1218 crystal_symmetry=None,
> 1219 weak_symmetry=False):
> -> 1220 self_symmetry = self.crystal_symmetry_from_cryst1()
> 1221 if (self_symmetry is None):
> 1222 self_symmetry = self._crystal_symmetry_from_cns_remark_sg()
>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> crystal_symmetry_from_cryst1(self)
> 1195 for line in self.crystallographic_section():
> 1196 if (line.startswith("CRYST1")):
> -> 1197 return
> cryst1_interpretation.crystal_symmetry(cryst1_record=line)
> 1198 return None
> 1199
>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__cryst1-5Finterpretation.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=3OchLb18AMp3YpXOuEb8BDOwhl2XLrV1QAfZByH-l2E&e=
> in crystal_symmetry(cryst1_record)
> 136 space_group_info=None)
> 137 space_group_info =
> categorize(cryst1_record.sgroup).space_group_info(
> --> 138 unit_cell=u)
> 139 return crystal.symmetry(unit_cell=u,
> space_group_info=space_group_info)
>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/pdb/https://urldefense.proofpoint.com/v2/url?u=http-3A__cryst1-5Finterpretation.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=3OchLb18AMp3YpXOuEb8BDOwhl2XLrV1QAfZByH-l2E&e=
> in space_group_info(self, unit_cell)
> 85 if (self.symbol is None): return None
> 86 if (self.category is None):
> ---> 87 try: return sgtbx.space_group_info(self.symbol)
> 88 except RuntimeError: return None
> 89 if (isinstance(unit_cell, uctbx.ext.unit_cell)):
>
> ~/anaconda3/lib/python3.6/site-packages/cctbx/sgtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> __init__(self, symbol, table_id, group, number, space_group_t_den)
> 100 assert group is None
> 101 if (table_id is None):
> --> 102 symbols = space_group_symbols(symbol)
> 103 else:
> 104 if (isinstance(symbol, int)): symbol = str(symbol)
>
> ArgumentError: Python argument types in
> space_group_symbols.__init__(space_group_symbols, str)
> did not match C++ signature:
> __init__(_object*, int space_group_number)
> __init__(_object*, int space_group_number,
> std::__cxx11::basic_string<char, std::char_traits<char>,
> std::allocator<char> > extension='')
> __init__(_object*, int space_group_number,
> std::__cxx11::basic_string<char, std::char_traits<char>,
> std::allocator<char> > extension='', std::__cxx11::basic_string<char,
> std::char_traits<char>, std::allocator<char> > table_id='')
> __init__(_object*, std::__cxx11::basic_string<char,
> std::char_traits<char>, std::allocator<char> > symbol)
> __init__(_object*, std::__cxx11::basic_string<char,
> std::char_traits<char>, std::allocator<char> > symbol,
> std::__cxx11::basic_string<char, std::char_traits<char>,
> std::allocator<char> > table_id='')
>
>
> Gergely
>
>
>
> On Fri, Jan 3, 2020 at 1:44 PM Gergely Katona <gkatona(a)gmail.com> wrote:
> >
> > Dear Billy,
> >
> > I did some tests installing in my base conda was not troublefree in
> > python 3.8. Running iotbx.fetch_pdb --all --mtz 1kp8 resulted in boost
> > related error when converting to mtz. Installing into a test
> > environment went fine with iotbx.fetch_pdb --all --mtz 1kp8 running
> > successfully. I could add pymc3, jupyter and seaborn and iotbx still
> > did not break. My LIBTBX_BUILD is not set however in the test
> > environment, which breaks miller when I was trying to import it.
> > Manually setting the LIBTBX_BUILD to CONDA_PREFIX (setenv LIBTBX_BUILD
> > $CONDA_PREFIX) fixes this and one of my script works fine! I will come
> > back if I find some problems with my other scripts, but so far this
> > looks promising!
> >
> >
> > Happy new year!
> >
> > Gergely
> >
> >
> >
> >
> >
> > On Fri, Dec 20, 2019 at 8:16 PM Billy Poon <BKPoon(a)lbl.gov> wrote:
> > >
> > > Hi everyone,
> > >
> > > I updated the conda packages on the cctbx-dev channel and there are
> also now packages for macOS. The old packages have been removed so you can
> create a new environment with
> > >
> > > conda create -n test -c cctbx-dev cctbx python=2.7
> > > conda activate test
> > >
> > > where "test" is the environment name and 2.7 is the python version.
> For the python version, you can also pick 3.6, 3.7, or 3.8. I think the
> latest conda will install 3.8 as the default python if the python argument
> is not provided. Or install into an existing environment (with python
> already installed) with the same command as before,
> > >
> > > conda install -c cctbx-dev cctbx
> > >
> > > Again, your .condarc file should have conda-forge as the first channel
> so that dependencies can be pulled correctly.
> > >
> > > The dispatchers should work now and $LIBTBX_BUILD will be set on
> activation of an environment (and unset on environment deactivation) or
> after installing into an existing environment, so you can do more
> interesting things like
> > >
> > > iotbx.fetch_pdb --all --mtz 1kp8
> > >
> > > However, this package does not install databases, so
> > >
> > > molprobity.molprobity 1kp8.pdb 1kp8.mtz
> > >
> > > will fail because the database is not available (also probe and reduce
> are not built).
> > >
> > > Some known issues in no particular order,
> > >
> > > 1) You can run "libtbx.run_tests_parallel module=cctbx nproc=Auto" to
> run tests, but not all the test files were copied, so I got 30 failures
> here. The final package will probably not have the test files.
> > > 2) The other python dispatchers, like "cctbx.python", were not
> updated, so those will fail. But you can just run "python" in the active
> environment.
> > > 3) Parts of mmtbx still need to be updated for Python 3.
> > > 4) The LIBTBX_BUILD variable should be set for sh and csh shells. Let
> me know if it's not working for your shell (i.e. "echo $LIBTBX_BUILD"
> should show the same thing as $CONDA_PREFIX).
> > > 5) One future step is to enable building other CCTBX-like modules with
> this conda package. This will require some bookkeeping updates so that
> modules in the conda environment and the modules being built are tracked
> properly. Also, making sure that all the necessary headers exist in
> $PREFIX/include.
> > >
> > > Gergely, let me know if your scripts are working.
> > >
> > > Happy holidays!
> > >
> > > --
> > > Billy K. Poon
> > > Research Scientist, Molecular Biophysics and Integrated Bioimaging
> > > Lawrence Berkeley National Laboratory
> > > 1 Cyclotron Road, M/S 33R0345
> > > Berkeley, CA 94720
> > > Tel: (510) 486-5709
> > > Fax: (510) 486-5909
> > > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >
> > >
> > > On Wed, Dec 18, 2019 at 11:25 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
> > >>
> > >> Hi Gergely,
> > >>
> > >> That's the other information that hasn't been updated yet in the
> conda package. :)
> > >>
> > >> For LIBTBX_BUILD, I can set up environment variables sort of how the
> conda gcc package sets up environment variables. I have to double check to
> see if they're set after installation of the package and after activation
> of an environment. The variable will just be a copy of $CONDA_PREFIX.
> > >>
> > >> The libtbx_env file is a file that exists in $LIBTBX_BUILD that
> basically stores configuration information. I'll have to modify the
> contents to update the locations of the different modules since the conda
> package will not have a "modules" directory.
> > >>
> > >> --
> > >> Billy K. Poon
> > >> Research Scientist, Molecular Biophysics and Integrated Bioimaging
> > >> Lawrence Berkeley National Laboratory
> > >> 1 Cyclotron Road, M/S 33R0345
> > >> Berkeley, CA 94720
> > >> Tel: (510) 486-5709
> > >> Fax: (510) 486-5909
> > >> Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >>
> > >>
> > >> On Wed, Dec 18, 2019 at 2:08 AM Gergely Katona <gkatona(a)gmail.com>
> wrote:
> > >>>
> > >>> Hi Billy,
> > >>>
> > >>> Conda install went fine with your instructions after rearranging the
> > >>> channels by putting cctbx last. I removed all environmental variables
> > >>> and previous build of cctbx.
> > >>>
> > >>> import sys
> > >>> print (sys.path, sys.prefix)
> > >>>
> > >>> ['/home/gergely/anaconda3/lib/https://urldefense.proofpoint.com/v2/url?u=http-3A__python36.zip&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=cUHL8qgeloeUO3oYTQcr9d56RegJk01wJ2i-c3Zo6oE&e= ',
> > >>> '/home/gergely/anaconda3/lib/python3.6',
> > >>> '/home/gergely/anaconda3/lib/python3.6/lib-dynload', '',
> > >>> '/home/gergely/anaconda3/lib/python3.6/site-packages',
> > >>>
> '/home/gergely/anaconda3/lib/python3.6/site-packages/IPython/extensions',
> > >>> '/home/gergely/.ipython'] /home/gergely/anaconda3
> > >>>
> > >>> Many imports went fine including pymc3, but I encountered problems
> > >>> with these three:
> > >>>
> > >>> from cctbx import miller
> > >>> import iotbx.pdb
> > >>> from iotbx import reflection_file_reader, mtz
> > >>>
> > >>>
> > >>> I also got type error when handling space groups.
> > >>>
> > >>>
> > >>>
> > >>>
> ---------------------------------------------------------------------------
> > >>> KeyError Traceback (most recent
> call last)
> > >>> <ipython-input-5-cedbd4f84f3d> in <module>
> > >>> 25 from cctbx import uctbx
> > >>> 26 from cctbx import sgtbx
> > >>> ---> 27 from cctbx import miller
> > >>> 28 #from iotbx import reflection_file_reader, mtz
> > >>> 29 sns.set_context("poster")
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> <module>
> > >>> 11
> > >>> 12 from cctbx import crystal
> > >>> ---> 13 from cctbx import maptbx
> > >>> 14 from cctbx import sgtbx
> > >>> 15 from cctbx.sgtbx import lattice_symmetry
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/maptbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> <module>
> > >>> 15 from libtbx import adopt_init_args
> > >>> 16 from libtbx.utils import Sorry
> > >>> ---> 17 import libtbx.load_env
> > >>> 18 import math
> > >>> 19 import sys, os
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e= in
> <module>
> > >>> 3 import libtbx.env_config
> > >>> 4 import os
> > >>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
> > >>> 6 libtbx.env.set_os_environ_all_dist()
> > >>> 7 libtbx.env.dispatcher_name =
> os.environ.get("LIBTBX_DISPATCHER_NAME")
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e= in
> unpickle()
> > >>> 2603
> > >>> 2604 def unpickle():
> > >>> -> 2605 build_path = os.environ["LIBTBX_BUILD"]
> > >>> 2606
> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
> > >>> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
> > >>>
> > >>> ~/anaconda3/lib/python3.6/https://urldefense.proofpoint.com/v2/url?u=http-3A__os.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=hA1zo5wap0c9wK3DrlWIKqYBIqqbfKXca5jQ9aX5pYU&e= in __getitem__(self, key)
> > >>> 667 except KeyError:
> > >>> 668 # raise KeyError with the original key value
> > >>> --> 669 raise KeyError(key) from None
> > >>> 670 return self.decodevalue(value)
> > >>> 671
> > >>>
> > >>> KeyError: 'LIBTBX_BUILD'
> > >>>
> > >>>
> > >>>
> > >>>
> ---------------------------------------------------------------------------
> > >>> ArgumentError Traceback (most recent
> call last)
> > >>> <ipython-input-7-2acd3a9ce26a> in <module>
> > >>> 26 return
> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar
> > >>> 27
> > >>> ---> 28
> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar=initializecrystal()
> > >>>
> > >>> <ipython-input-7-2acd3a9ce26a> in initializecrystal()
> > >>> 11 uc = uctbx.unit_cell(unit_cell)
> > >>> 12 wavelength = 1.54980
> > >>> ---> 13 xtal_symm = crystal.symmetry(unit_cell=unit_cell,
> > >>> space_group_symbol="P 43 21 2")
> > >>> 14
> > >>> 15 ms =
> > >>> miller.build_set(crystal_symmetry=xtal_symm,anomalous_flag=True,
> > >>> d_min=1.61)
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/crystal/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> > >>> __init__(self, unit_cell, space_group_symbol, space_group_info,
> > >>> space_group, correct_rhombohedral_setting_if_necessary,
> > >>> assert_is_compatible_unit_cell,
> raise_sorry_if_incompatible_unit_cell,
> > >>> force_compatible_unit_cell)
> > >>> 74 if (space_group_symbol is not None):
> > >>> 75 self._space_group_info = sgtbx.space_group_info(
> > >>> ---> 76 symbol=space_group_symbol)
> > >>> 77 elif (space_group is not None):
> > >>> 78 if (isinstance(space_group, sgtbx.space_group)):
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/cctbx/sgtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> > >>> __init__(self, symbol, table_id, group, number, space_group_t_den)
> > >>> 100 assert group is None
> > >>> 101 if (table_id is None):
> > >>> --> 102 symbols = space_group_symbols(symbol)
> > >>> 103 else:
> > >>> 104 if (isinstance(symbol, int)): symbol = str(symbol)
> > >>>
> > >>> ArgumentError: Python argument types in
> > >>> space_group_symbols.__init__(space_group_symbols, str)
> > >>> did not match C++ signature:
> > >>> __init__(_object*, int space_group_number)
> > >>> __init__(_object*, int space_group_number,
> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
> > >>> std::allocator<char> > extension='')
> > >>> __init__(_object*, int space_group_number,
> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
> > >>> std::allocator<char> > extension='', std::__cxx11::basic_string<char,
> > >>> std::char_traits<char>, std::allocator<char> > table_id='')
> > >>> __init__(_object*, std::__cxx11::basic_string<char,
> > >>> std::char_traits<char>, std::allocator<char> > symbol)
> > >>> __init__(_object*, std::__cxx11::basic_string<char,
> > >>> std::char_traits<char>, std::allocator<char> > symbol,
> > >>> std::__cxx11::basic_string<char, std::char_traits<char>,
> > >>> std::allocator<char> > table_id='')
> > >>>
> > >>>
> > >>> When I tried to set LIBTBX_BUILD to /home/gergely/anaconda3 (this is
> > >>> sys.prefix on my system), I got other problems when importing. Can
> > >>> LIBTBX_BUILD be set in the conda package?
> > >>>
> > >>>
> > >>>
> > >>>
> ---------------------------------------------------------------------------
> > >>> FileNotFoundError Traceback (most recent
> call last)
> > >>> <ipython-input-1-7e2b144826cc> in <module>
> > >>> 26 from cctbx import sgtbx
> > >>> 27 #from cctbx import miller
> > >>> ---> 28 from iotbx import reflection_file_reader, mtz
> > >>> 29 sns.set_context("poster")
> > >>> 30 plt.rcParams.update({'figure.autolayout': True})
> > >>>
> > >>>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__reflection-5Ffile-5Freader.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=U5BvLmuCgufvN_LRxQw9n78p33jNaRrXVbH1BRSXgxg&e=
> > >>> in <module>
> > >>> 53
> > >>> 54 from __future__ import absolute_import, division,
> print_function
> > >>> ---> 55 from iotbx import mtz
> > >>> 56 from iotbx.scalepack import merge as scalepack_merge
> > >>> 57 from iotbx.scalepack import no_merge_original_index as
> > >>> scalepack_no_merge
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=9NiF4LTTyEpDCh-vdb5bXVIJ4i9E6HmD6eWJg_3SjzE&e= in
> <module>
> > >>> 9 import iotbx_mtz_ext as ext
> > >>> 10
> > >>> ---> 11 from iotbx.mtz import extract_from_symmetry_lib
> > >>> 12 from cctbx import xray
> > >>> 13 import cctbx.xray.observation_types
> > >>>
> > >>>
> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__extract-5Ffrom-5Fsymmetry-5Flib.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=k3WR6VZd4-PDULPXl4O0Vwz9q3LCaocUUhK_ehTn9UE&e=
> > >>> in <module>
> > >>> 1 from __future__ import absolute_import, division,
> print_function
> > >>> 2 from cctbx import sgtbx
> > >>> ----> 3 import libtbx.load_env
> > >>> 4 import os.path as op
> > >>> 5 from six.moves import range
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=rJbfdPr3ymiz7Ir508_VGIhspAKCOwozKhY5I6OXux0&e= in
> <module>
> > >>> 3 import libtbx.env_config
> > >>> 4 import os
> > >>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
> > >>> 6 libtbx.env.set_os_environ_all_dist()
> > >>> 7 libtbx.env.dispatcher_name =
> os.environ.get("LIBTBX_DISPATCHER_NAME")
> > >>>
> > >>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=9IjF95nqsrMq_R_HHQ4nsTpGpSpiU2e4ynF8kN3qTHY&s=UrsFhQ0dxNNuzXmOT3D6pnGJ5lXko4mfrKceNgBaQV4&e= in
> unpickle()
> > >>> 2605 build_path = os.environ["LIBTBX_BUILD"]
> > >>> 2606
> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
> > >>> -> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
> > >>> 2608 env = pickle.load(libtbx_env)
> > >>> 2609 if (env.python_version_major_minor !=
> sys.version_info[:2]):
> > >>>
> > >>> FileNotFoundError: [Errno 2] No such file or directory:
> > >>> '/home/gergely/anaconda3/libtbx_env'
> > >>>
> > >>> On Wed, Dec 18, 2019 at 9:10 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
> > >>> >
> > >>> > Hi Gergely,
> > >>> >
> > >>> > I've uploaded linux packages to a new channel, cctbx-dev, and you
> can install it with
> > >>> >
> > >>> > conda install -c cctbx-dev cctbx
> > >>> >
> > >>> > in your current environment. You should set your ~/.condarc file
> to pull the other dependencies from the conda-forge channel first, so put
> conda-forge above cctbx. Mine looks like
> > >>> >
> > >>> > channels:
> > >>> > - conda-forge
> > >>> > - defaults
> > >>> > - cctbx
> > >>> >
> > >>> > Do you need dxtbx for your scripts? This package does not build
> that part. I think the plan is to build a separate conda package for dxtbx
> so that it can be updated more frequently. I can rebuild the packages to
> include it for testing, but the one being submitted to conda-forge will not
> have it.
> > >>> >
> > >>> > Also, your error message is probably due to version of HDF5 that
> the development build installs. The https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… script will install
> 1.10.4, but your other dependency is looking for 1.10.5. Installing this
> cctbx conda package should install 1.10.5, which should fix the issue.
> Also, I'm updating those environments and 1.10.5 will be the new default
> version.
> > >>> >
> > >>> > Lastly, the dispatchers will not work in these packages because
> the old paths during the build process are still in them and many of them
> expect some additional information that has not been updated in the
> packages yet. I'm in the process of doing that and will update the
> cctbx-dev channel when that's done. However, by starting python, you can
> import cctbx modules. So you can run commands like
> > >>> >
> > >>> > from scitbx.array_family import flex
> > >>> > a = flex.random_double(1000000)
> > >>> > b = flex.min_max_mean_double(a)
> > >>> > b.min
> > >>> > b.max
> > >>> > b.mean
> > >>> >
> > >>> > Thanks!
> > >>> >
> > >>> > --
> > >>> > Billy K. Poon
> > >>> > Research Scientist, Molecular Biophysics and Integrated Bioimaging
> > >>> > Lawrence Berkeley National Laboratory
> > >>> > 1 Cyclotron Road, M/S 33R0345
> > >>> > Berkeley, CA 94720
> > >>> > Tel: (510) 486-5709
> > >>> > Fax: (510) 486-5909
> > >>> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >>> >
> > >>> >
> > >>> > On Tue, Dec 17, 2019 at 5:39 AM Gergely Katona <gkatona(a)gmail.com>
> wrote:
> > >>> >>
> > >>> >> Dear Billy,
> > >>> >>
> > >>> >> Thank you for the detailed explanation, I look forward to do
> further
> > >>> >> testing! I aim to pool all modules under the same environment, if
> > >>> >> there are conflicts then I just try to reshuffle the order of
> imports.
> > >>> >> So far this did not cause problems for me even when I was using
> system
> > >>> >> python, but of course it is not the most prudent thing to do. With
> > >>> >> anaconda everything is much more standardized and isolated
> already and
> > >>> >> without being superuser I can have my familiar environment at any
> > >>> >> synchrotron based cluster. It is great that cctbx will be an
> integral
> > >>> >> part of this ecosystem and this was also the last thing holding me
> > >>> >> back from adopting python3. About hdf5, pymc3 requires it and
> > >>> >> importing causes a kernel restart with the following error
> messages,
> > >>> >> curiously if I import h5py first this can be avoided.
> > >>> >>
> > >>> >> Best wishes,
> > >>> >>
> > >>> >> Gergely
> > >>> >>
> > >>> >> import pymc3 as pm
> > >>> >>
> > >>> >> Warning! ***HDF5 library version mismatched error***
> > >>> >> The HDF5 header files used to compile this application do not
> match
> > >>> >> the version used by the HDF5 library to which this application is
> linked.
> > >>> >> Data corruption or segmentation faults may occur if the
> application continues.
> > >>> >> This can happen when an application was compiled by one version
> of HDF5 but
> > >>> >> linked with a different version of static or shared HDF5 library.
> > >>> >> You should recompile the application or check your shared library
> related
> > >>> >> settings such as 'LD_LIBRARY_PATH'.
> > >>> >> You can, at your own risk, disable this warning by setting the
> environment
> > >>> >> variable 'HDF5_DISABLE_VERSION_CHECK' to a value of '1'.
> > >>> >> Setting it to 2 or higher will suppress the warning messages
> totally.
> > >>> >> Headers are 1.10.4, library is 1.10.5
> > >>> >> SUMMARY OF THE HDF5 CONFIGURATION
> > >>> >> =================================
> > >>> >>
> > >>> >> General Information:
> > >>> >> -------------------
> > >>> >> HDF5 Version: 1.10.5
> > >>> >> Configured on: Tue Oct 22 12:02:13 UTC 2019
> > >>> >> Configured by: conda@16247e67ecd5
> > >>> >> Host system: x86_64-conda_cos6-linux-gnu
> > >>> >> Uname information: Linux 16247e67ecd5
> 4.15.0-1059-azure
> > >>> >> #64-Ubuntu SMP Fri Sep 13 17:02:44 UTC 2019 x86_64 x86_64 x86_64
> > >>> >> GNU/Linux
> > >>> >> Byte sex: little-endian
> > >>> >> Installation point: /home/gergely/anaconda3
> > >>> >>
> > >>> >> Compiling Options:
> > >>> >> ------------------
> > >>> >> Build Mode: production
> > >>> >> Debugging Symbols: no
> > >>> >> Asserts: no
> > >>> >> Profiling: no
> > >>> >> Optimization Level: high
> > >>> >>
> > >>> >> Linking Options:
> > >>> >> ----------------
> > >>> >> Libraries: static, shared
> > >>> >> Statically Linked Executables:
> > >>> >> LDFLAGS: -Wl,-O2 -Wl,--sort-common
> > >>> >> -Wl,--as-needed -Wl,-z,relro -Wl,-z,now -Wl,--disable-new-dtags
> > >>> >> -Wl,--gc-sections -Wl,-rpath,/home/gergely/anaconda3/lib
> > >>> >> -Wl,-rpath-link,/home/gergely/anaconda3/lib
> > >>> >> -L/home/gergely/anaconda3/lib
> > >>> >> H5_LDFLAGS:
> > >>> >> AM_LDFLAGS: -L/home/gergely/anaconda3/lib
> > >>> >> Extra libraries: -lrt -lpthread -lz -ldl -lm
> > >>> >> Archiver:
> > >>> >>
> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ar
> > >>> >> AR_FLAGS: cr
> > >>> >> Ranlib:
> > >>> >>
> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ranlib
> > >>> >>
> > >>> >> Languages:
> > >>> >> ----------
> > >>> >> C: yes
> > >>> >> C Compiler:
> > >>> >>
> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-cc
> > >>> >> CPPFLAGS: -DNDEBUG -D_FORTIFY_SOURCE=2 -O2
> > >>> >> -I/home/gergely/anaconda3/include
> > >>> >> H5_CPPFLAGS: -D_GNU_SOURCE
> > >>> >> -D_POSIX_C_SOURCE=200809L -DNDEBUG -UH5_DEBUG_API
> > >>> >> AM_CPPFLAGS:
> -I/home/gergely/anaconda3/include
> > >>> >> C Flags: -march=nocona -mtune=haswell
> > >>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
> > >>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
> > >>> >>
> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
> > >>> >>
> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
> > >>> >> H5 C Flags: -std=c99 -pedantic -Wall
> -Wextra
> > >>> >> -Wbad-function-cast -Wc++-compat -Wcast-align -Wcast-qual
> -Wconversion
> > >>> >> -Wdeclaration-after-statement -Wdisabled-optimization
> -Wfloat-equal
> > >>> >> -Wformat=2 -Winit-self -Winvalid-pch -Wmissing-declarations
> > >>> >> -Wmissing-include-dirs -Wmissing-prototypes -Wnested-externs
> > >>> >> -Wold-style-definition -Wpacked -Wpointer-arith -Wredundant-decls
> > >>> >> -Wshadow -Wstrict-prototypes -Wswitch-default -Wswitch-enum
> -Wundef
> > >>> >> -Wunused-macros -Wunsafe-loop-optimizations -Wwrite-strings
> > >>> >> -finline-functions -s -Wno-inline -Wno-aggregate-return
> > >>> >> -Wno-missing-format-attribute -Wno-missing-noreturn -O
> > >>> >> AM C Flags:
> > >>> >> Shared C Library: yes
> > >>> >> Static C Library: yes
> > >>> >>
> > >>> >>
> > >>> >> Fortran: yes
> > >>> >> Fortran Compiler:
> > >>> >>
> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-gfortran
> > >>> >> Fortran Flags:
> > >>> >> H5 Fortran Flags: -pedantic -Wall -Wextra
> -Wunderflow
> > >>> >> -Wimplicit-interface -Wsurprising -Wno-c-binding-type -s -O2
> > >>> >> AM Fortran Flags:
> > >>> >> Shared Fortran Library: yes
> > >>> >> Static Fortran Library: yes
> > >>> >>
> > >>> >> C++: yes
> > >>> >> C++ Compiler:
> > >>> >>
> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-c++
> > >>> >> C++ Flags: -fvisibility-inlines-hidden
> > >>> >> -std=c++17 -fmessage-length=0 -march=nocona -mtune=haswell
> > >>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
> > >>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
> > >>> >>
> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
> > >>> >>
> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
> > >>> >> H5 C++ Flags: -pedantic -Wall -W -Wundef
> -Wshadow
> > >>> >> -Wpointer-arith -Wcast-qual -Wcast-align -Wwrite-strings
> -Wconversion
> > >>> >> -Wredundant-decls -Winline -Wsign-promo -Woverloaded-virtual
> > >>> >> -Wold-style-cast -Weffc++ -Wreorder -Wnon-virtual-dtor
> > >>> >> -Wctor-dtor-privacy -Wabi -finline-functions -s -O
> > >>> >> AM C++ Flags:
> > >>> >> Shared C++ Library: yes
> > >>> >> Static C++ Library: yes
> > >>> >>
> > >>> >> Java: no
> > >>> >>
> > >>> >>
> > >>> >> Features:
> > >>> >> ---------
> > >>> >> Parallel HDF5: no
> > >>> >> Parallel Filtered Dataset Writes: no
> > >>> >> Large Parallel I/O: no
> > >>> >> High-level library: yes
> > >>> >> Threadsafety: yes
> > >>> >> Default API mapping: v110
> > >>> >> With deprecated public symbols: yes
> > >>> >> I/O filters (external): deflate(zlib)
> > >>> >> MPE: no
> > >>> >> Direct VFD: no
> > >>> >> dmalloc: no
> > >>> >> Packages w/ extra debug output: none
> > >>> >> API tracing: no
> > >>> >> Using memory checker: yes
> > >>> >> Memory allocation sanity checks: no
> > >>> >> Function stack tracing: no
> > >>> >> Strict file format checks: no
> > >>> >> Optimization instrumentation: no
> > >>> >>
> > >>> >> On Tue, Dec 17, 2019 at 8:35 AM Billy Poon <BKPoon(a)lbl.gov>
> wrote:
> > >>> >> >
> > >>> >> > Hi Gergely,
> > >>> >> >
> > >>> >> > Let me build the test package tomorrow. All the gritty details
> for building with conda is being finalized and the official documentation
> will be updated to describe the steps. It would be too confusing to keep
> changing the documentation as the process evolves. You do have the general
> process, though, which is summarized as follows.
> > >>> >> >
> > >>> >> > 1) Installing dependencies. The cctbx_dependencies metapackage
> was an initial approach for managing the CCTBX dependencies, but after
> contacting the conda-forge folks, they recommended using the --only-deps
> flag. So when the CCTBX conda package is available, you'll be able to get a
> set of dependencies with,
> > >>> >> >
> > >>> >> > conda install -c conda-forge --only-deps cctbx
> > >>> >> >
> > >>> >> > By default, the https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file will automatically install a
> set of dependencies in the "conda_base" directory (and a conda installation
> if one is not found). It just uses standard conda environment files located
> in libtbx/auto_build/conda_envs, so you do not need to install
> cctbx_dependencies as a separate step. The environment files avoid channel
> issues by explicitly defining the channel to pull the packages from and the
> cctbx channel just stores copies of packages from conda-forge. There were
> issues earlier where the conda-forge packages would sometimes be moved to a
> different label. The --use-conda flag also accepts a path to $CONDA_PREFIX
> if you want to use a specific environment for testing.
> > >>> >> >
> > >>> >> > 2) Building. The https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file handles that with SCons.
> > >>> >> >
> > >>> >> > 3) Running. After building, there should be a https://urldefense.proofpoint.com/v2/url?u=http-3A__setpaths.sh&d=DwICAg&c=… (and
> .csh) file that adds build/bin to your path. The build/bin directory has
> our dispatchers, which are just scripts that set up the environment
> variables for you. This prevents other programs from loading our libraries,
> whose versions may conflict. You should see that there is a "python"
> dispatcher, which is a convenience for developers. Otherwise, you can use
> libtbx.python, which will be able to import CCTBX modules.
> > >>> >> >
> > >>> >> > The running part is where the conda package for CCTBX will be
> different than this build. Since our Python files and extensions modules
> will be in the "site-packages" directory for Python, the PYTHONPATH
> variable will not be needed (and conda suggests that that variable not be
> set). The other CCTBX libraries will be in $CONDA_PREFIX/lib, so
> LD_LIBRARY_PATH is not needed. In an active environment, PATH will already
> be modified. And then our LIBTBX_BUILD directory can be set to sys.prefix.
> > >>> >> >
> > >>> >> > So with the conda package, you would only need to activate your
> conda environment and CCTBX should integrate with other conda packages.
> What is the conflict with hdf5? That's something that should be fixed.
> Thanks!
> > >>> >> >
> > >>> >> > --
> > >>> >> > Billy K. Poon
> > >>> >> > Research Scientist, Molecular Biophysics and Integrated
> Bioimaging
> > >>> >> > Lawrence Berkeley National Laboratory
> > >>> >> > 1 Cyclotron Road, M/S 33R0345
> > >>> >> > Berkeley, CA 94720
> > >>> >> > Tel: (510) 486-5709
> > >>> >> > Fax: (510) 486-5909
> > >>> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >>> >> >
> > >>> >> >
> > >>> >> > On Mon, Dec 16, 2019 at 2:53 AM Gergely Katona <
> gkatona(a)gmail.com> wrote:
> > >>> >> >>
> > >>> >> >> Dear Billy,
> > >>> >> >>
> > >>> >> >> Thank you for this update and for your efforts! I found a
> solution and
> > >>> >> >> indeed most things already work in anaconda3. The steps I took
> (even
> > >>> >> >> if these instructions will have short expiry date):
> > >>> >> >>
> > >>> >> >> Modified .condarc with:
> > >>> >> >> channels:
> > >>> >> >> - cctbx
> > >>> >> >> - conda-forge
> > >>> >> >> - defaults
> > >>> >> >>
> > >>> >> >> run
> > >>> >> >> conda conda install cctbx_dependencies python=3.6
> > >>> >> >>
> > >>> >> >> I expect this will work without python=3.6 in the near future.
> > >>> >> >>
> > >>> >> >> Then compiling cctbx with anaconda3 python went without any
> problem
> > >>> >> >> when using these flags:
> > >>> >> >> python https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… --use-conda --python3 --nproc=12
> > >>> >> >>
> > >>> >> >> Then I probably did the unorthodox thing and sourced these
> directories:
> > >>> >> >>
> > >>> >> >> setenv LIBTBX_BUILD /home/gergely/cctbx/build
> > >>> >> >> setenv PATH ${PATH}:/home/gergely/cctbx/build/bin
> > >>> >> >> setenv PYTHONPATH
> > >>> >> >>
> /home/gergely/cctbx/modules/cctbx_project:/home/gergely/cctbx/modules:/home/gergely/cctbx/modules/cctbx_project/boost_adaptbx:/home/gergely/cctbx/build/lib:/home/gergely/cctbx/conda_base/lib/python3.6/site-packages:$PYTHONPATH
> > >>> >> >> setenv LD_LIBRARY_PATH
> > >>> >> >>
> /home/gergely/cctbx/conda_base/lib:/home/gergely/cctbx/build/lib:$LD_LIBRARY_PATH
> > >>> >> >>
> > >>> >> >> There is probably a better way to put this into conda
> environment.
> > >>> >> >> With these steps I could run one of my scripts depending on
> cctbx. The
> > >>> >> >> only problem I found is that hdf5 library had conflict with
> another
> > >>> >> >> package in conda, but I does not find this as a showstopper.
> > >>> >> >>
> > >>> >> >> Best wishes,
> > >>> >> >>
> > >>> >> >> Gergely
> > >>> >> >>
> > >>> >> >>
> > >>> >> >>
> > >>> >> >>
> > >>> >> >>
> > >>> >> >>
> > >>> >> >> On Fri, Dec 13, 2019 at 7:23 PM Billy Poon <BKPoon(a)lbl.gov>
> wrote:
> > >>> >> >> >
> > >>> >> >> > Hi Gergely,
> > >>> >> >> >
> > >>> >> >> > It's still a work in progress. I'm sorting out some Windows
> issues right now. I can probably build a test package on a separate channel
> for people that want to test it (let's say next week?). I'll provide
> instructions, but basically, the test conda package will be in its own
> separate channel and the dependencies will be pulled from the conda-forge
> channel. I want most things to be working correctly on Python 2.7, 3.6,
> 3.7, and 3.8 on all 3 platforms.
> > >>> >> >> >
> > >>> >> >> > Thanks!
> > >>> >> >> >
> > >>> >> >> > --
> > >>> >> >> > Billy K. Poon
> > >>> >> >> > Research Scientist, Molecular Biophysics and Integrated
> Bioimaging
> > >>> >> >> > Lawrence Berkeley National Laboratory
> > >>> >> >> > 1 Cyclotron Road, M/S 33R0345
> > >>> >> >> > Berkeley, CA 94720
> > >>> >> >> > Tel: (510) 486-5709
> > >>> >> >> > Fax: (510) 486-5909
> > >>> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >>> >> >> >
> > >>> >> >> >
> > >>> >> >> > On Fri, Dec 13, 2019 at 5:44 AM Gergely Katona <
> gkatona(a)gmail.com> wrote:
> > >>> >> >> >>
> > >>> >> >> >> Dear Billy,
> > >>> >> >> >>
> > >>> >> >> >> This sounds very promising and exciting. I am not sure if
> cctbx is
> > >>> >> >> >> already functional as a conda package in anaconda3 (Linux)
> or this is
> > >>> >> >> >> still work in progress. My technical expertise does not
> allow me to
> > >>> >> >> >> tell the difference. What I tried:
> > >>> >> >> >>
> > >>> >> >> >> Fresh install of anaconda3. Adding - cctbx and -
> conda-forge to
> > >>> >> >> >> .condarc . Installing pyside2 with conda. Running conda
> install
> > >>> >> >> >> conda_dependencies . I get a lot package version conflict,
> and I
> > >>> >> >> >> cannot import cctbx or iotbx to anaconda python. Am I
> following the
> > >>> >> >> >> right instructions? Or it is too early to expect that cctbx
> works when
> > >>> >> >> >> installed through conda?
> > >>> >> >> >>
> > >>> >> >> >> Best wishes,
> > >>> >> >> >>
> > >>> >> >> >> Gergely
> > >>> >> >> >>
> > >>> >> >> >> On Wed, Nov 27, 2019 at 3:56 PM Billy Poon <BKPoon(a)lbl.gov>
> wrote:
> > >>> >> >> >> >
> > >>> >> >> >> > Hi all,
> > >>> >> >> >> >
> > >>> >> >> >> > For a brief update, I have submitted a recipe for
> cctbxlite to conda-forge (
> https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_conda-2Dfor… ) and support for
> Python 3.7 and 3.8 is being added (
> https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx… ). With some fixes for
> Windows (https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx… ), all platforms
> (macOS, linux, and Windows) can build for Python 2.7, 3.6, 3.7, and 3.8.
> Some additional changes will be needed to get Windows to work with Python 3
> and for tests to pass with Boost 1.70.0. That will enable the conda-forge
> recipe to build for all platforms and for all supported versions of Python.
> > >>> >> >> >> >
> > >>> >> >> >> > Currently, the conda-forge recipe will install into the
> conda python and cctbx imports can be done without sourcing the environment
> scripts. It looks like a lot of the environment variables being set in the
> dispatchers can be removed since the Python files and C++ extensions are in
> the right places. I'll update the libtbx_env file so that commands that
> load the environment can work correctly.
> > >>> >> >> >> >
> > >>> >> >> >> > --
> > >>> >> >> >> > Billy K. Poon
> > >>> >> >> >> > Research Scientist, Molecular Biophysics and Integrated
> Bioimaging
> > >>> >> >> >> > Lawrence Berkeley National Laboratory
> > >>> >> >> >> > 1 Cyclotron Road, M/S 33R0345
> > >>> >> >> >> > Berkeley, CA 94720
> > >>> >> >> >> > Tel: (510) 486-5709
> > >>> >> >> >> > Fax: (510) 486-5909
> > >>> >> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
> > >>> >> >> >> >
> > >>> >> >> >> >
> > >>> >> >> >> > On Sun, Aug 25, 2019 at 2:33 PM Tristan Croll <
> tic20(a)cam.ac.uk> wrote:
> > >>> >> >> >> >>
> > >>> >> >> >> >> Hi Luc,
> > >>> >> >> >> >>
> > >>> >> >> >> >> That sounds promising. From there, I?d need to work out
> how to make a fully-packaged installer (basically a modified wheel file)
> for the ChimeraX ToolShed - the aim is for the end user to not have to
> worry about any of this. That adds a couple of complications - e.g.
> $LIBTBX_BUILD would need to be set dynamically before first import - but
> doesn?t seem insurmountable.
> > >>> >> >> >> >>
> > >>> >> >> >> >> Thanks,
> > >>> >> >> >> >>
> > >>> >> >> >> >> Tristan
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >> Tristan Croll
> > >>> >> >> >> >> Research Fellow
> > >>> >> >> >> >> Cambridge Institute for Medical Research
> > >>> >> >> >> >> University of Cambridge CB2 0XY
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >> > On 25 Aug 2019, at 18:31, Luc Bourhis <
> luc_j_bourhis(a)mac.com> wrote:
> > >>> >> >> >> >> >
> > >>> >> >> >> >> > Hi Tristan,
> > >>> >> >> >> >> >
> > >>> >> >> >> >> > cctbx could be built to use your ChimeraX python, now
> that cctbx is moving to Python 3. The option ?with-python is there for that
> with the bootstrap script. The specific environment setup boil down to
> setting two environment variable LIBTBX_BUILD and either LD_LIBRARY_PATH on
> Linux, PATH on Win32, or DYLIB_LIBRARY_PATH on MacOS. If you work within a
> framework such as ChimeraX, that should not be difficult to ensure those
> two variables are set.
> > >>> >> >> >> >> >
> > >>> >> >> >> >> > Best wishes,
> > >>> >> >> >> >> >
> > >>> >> >> >> >> > Luc
> > >>> >> >> >> >> >
> > >>> >> >> >> >> >
> > >>> >> >> >> >> >> On 23 Aug 2019, at 19:02, Tristan Croll <
> tic20(a)cam.ac.uk> wrote:
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> To add my two cents on this: probably the second-most
> common question I've had about ISOLDE's implementation is, "why didn't you
> use CCTBX?". The honest answer to that is, "I didn't know how."
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> Still don't, really - although the current
> developments are rather promising. The problem I've faced is that CCTBX was
> designed as its own self-contained Python (2.7, until very recently)
> environment, with its own interpreter and a lot of very specific
> environment setup. Meanwhile I'm developing ISOLDE in ChimeraX, which is
> *also* its own self-contained Python (3.7) environment. To plug one into
> the other in that form... well, I don't think I'm a good enough programmer
> to really know where to start.
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> The move to Conda and a more modular CCTBX
> architecture should make a lot more possible in that direction. Pip would
> be even better for me personally (ChimeraX can install directly from the
> PyPI, but doesn't interact with Conda) - but I understand pretty well the
> substantial challenge that would amount to (not least being that the PyPI
> imposes a limit - around 100MB from memory? - on the size of an individual
> package).
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> Best regards,
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> Tristan
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >>> On 2019-08-23 09:28, Luc Bourhis wrote:
> > >>> >> >> >> >> >>> Hi Graeme,
> > >>> >> >> >> >> >>> Yes, I know. But ?black" is a program doing a very
> particular task
> > >>> >> >> >> >> >>> (code formatting from the top of my head). Requiring
> to use a wrapper
> > >>> >> >> >> >> >>> for python itself is another level. But ok, I think
> I am mellowing to
> > >>> >> >> >> >> >>> the idea after all! Talking with people around me,
> and extrapolating,
> > >>> >> >> >> >> >>> I would bet that, right now, a great majority of
> people interested by
> > >>> >> >> >> >> >>> cctbx in pip have already used the cctbx, so they
> know about the
> > >>> >> >> >> >> >>> Python wrapper, and they would not be too sanguine
> about that. My
> > >>> >> >> >> >> >>> concern is for the future, when pip will be the
> first time some people
> > >>> >> >> >> >> >>> use cctbx. Big fat warning notices on PyPI page and
> a better error
> > >>> >> >> >> >> >>> message when cctbx fails because LIBTBX_BUILD is not
> set would be
> > >>> >> >> >> >> >>> needed but that could be all right.
> > >>> >> >> >> >> >>> If we do a pip installer, we should aim at a minimal
> install: cctbx,
> > >>> >> >> >> >> >>> iotbx and their dependencies, and that?s it.
> > >>> >> >> >> >> >>> Best wishes,
> > >>> >> >> >> >> >>> Luc
> > >>> >> >> >> >> >>>> On 23 Aug 2019, at 07:17,
> Graeme.Winter(a)Diamond.ac.uk <Graeme.Winter(a)diamond.ac.uk> wrote:
> > >>> >> >> >> >> >>>> Without discussing the merits of this or whether we
> _choose_ to make the move to supporting PIP, I am certain it would be
> _possible_ - many other packages make dispatcher scripts when you pip
> install them e.g.
> > >>> >> >> >> >> >>>> Silver-Surfer rescale_f2 :) $ which black; cat
> $(which black)
> > >>> >> >> >> >> >>>>
> /Library/Frameworks/Python.framework/Versions/3.6/bin/black
> > >>> >> >> >> >> >>>>
> #!/Library/Frameworks/Python.framework/Versions/3.6/bin/python3.6
> > >>> >> >> >> >> >>>> # -*- coding: utf-8 -*-
> > >>> >> >> >> >> >>>> import re
> > >>> >> >> >> >> >>>> import sys
> > >>> >> >> >> >> >>>> from black import main
> > >>> >> >> >> >> >>>> if __name__ == '__main__':
> > >>> >> >> >> >> >>>> sys.argv[0] = re.sub(r'(-script\.pyw?|\.exe)?$',
> '', sys.argv[0])
> > >>> >> >> >> >> >>>> sys.exit(main())
> > >>> >> >> >> >> >>>> So we _could_ work around the absence of
> LIBTBX_BUILD etc. in the system. Whether or not we elect to do the work is
> a different question, and it seems clear that here are very mixed opinions
> on this.
> > >>> >> >> >> >> >>>> Best wishes Graeme
> > >>> >> >> >> >> >>>> On 23 Aug 2019, at 01:21, Luc Bourhis <
> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
> > >>> >> >> >> >> >>>> Hi,
> > >>> >> >> >> >> >>>> Even if we managed to ship our the boost dynamic
> libraries with pip, it would still not be pip-like, as we would still need
> our python wrappers to set LIBTBX_BUILD and LD_LIBRARY_PATH. Normal pip
> packages work with the standard python exe. LD_LIBRARY_PATH, we could get
> around that by changing the way we compile, using -Wl,-R, which is the
> runtime equivalent of build time -L. That?s a significant change that would
> need to be tested. But there is no way around setting LIBTBX_BUILD right
> now. Leaving that to the user is horrible. Perhaps there is a way to hack
> libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&… so that we can hardwire LIBTBX_BUILD in there when pip
> installs?
> > >>> >> >> >> >> >>>> Best wishes,
> > >>> >> >> >> >> >>>> Luc
> > >>> >> >> >> >> >>>> On 16 Aug 2019, at 22:47, Luc Bourhis <
> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
> > >>> >> >> >> >> >>>> Hi,
> > >>> >> >> >> >> >>>> I did look into that many years ago, and even toyed
> with building a pip installer. What stopped me is the exact conclusion you
> reached too: the user would not have the pip experience he expects. You are
> right that it is a lot of effort but is it worth it? Considering that
> remark, I don?t think so. Now, Conda was created specifically to go beyond
> pip pure-python-only support. Since cctbx has garnered support for Conda,
> the best avenue imho is to go the extra length to have a package on
> https://urldefense.proofpoint.com/v2/url?u=http-3A__Anaconda.org&d=DwICAg&c… <https://urldefense.proofpoint.com/v2/url?u=http-3A__anaconda.org_&d=DwICAg&… >, and then to advertise it hard to
> every potential user out there.
> > >>> >> >> >> >> >>>> Best wishes,
> > >>> >> >> >> >> >>>> Luc
> > >>> >> >> >> >> >>>> On 16 Aug 2019, at 21:45, Aaron Brewster <
> asbrewster(a)lbl.gov<mailto:[email protected]>> wrote:
> > >>> >> >> >> >> >>>> Hi, to avoid clouding Dorothee's documentation
> email thread, which I think is a highly useful enterprise, here's some
> thoughts about putting cctbx into pip. Pip doesn't install non-python
> dependencies well. I don't think boost is available as a package on pip
> (at least the package version we use). wxPython4 isn't portable through
> pip (
> https://urldefense.proofpoint.com/v2/url?u=https-3A__wiki.wxpython.org_How-… ).
> MPI libraries are system dependent. If cctbx were a pure python package,
> pip would be fine, but cctbx is not.
> > >>> >> >> >> >> >>>> All that said, we could build a manylinux1 version
> of cctbx and upload it to PyPi (I'm just learning about this). For a pip
> package to be portable (which is a requirement for cctbx), it needs to
> conform to PEP513, the manylinux1 standard (
> https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep… ). For example, numpy is built
> according to this standard (see https://urldefense.proofpoint.com/v2/url?u=https-3A__pypi.org_project_numpy… ,
> where you'll see the manylinux1 wheel). Note, the manylinux1 standard is
> built with Centos 5.11 which we no longer support.
> > >>> >> >> >> >> >>>> There is also a manylinux2010 standard, which is
> based on Centos 6 (https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep… ). This is
> likely a more attainable target (note though by default C++11 is not
> supported on Centos 6).
> > >>> >> >> >> >> >>>> If we built a manylinuxX version of cctbx and
> uploaded it to PyPi, the user would need all the non-python dependencies.
> There's no way to specify these in pip. For example, cctbx requires boost
> 1.63 or better. The user will need to have it in a place their python can
> find it, or we could package it ourselves and supply it, similar to how the
> pip h5py package now comes with an hd5f library, or how the pip numpy
> package includes an openblas library. We'd have to do the same for any
> packages we depend on that aren't on pip using the manylinux standards,
> such as wxPython4.
> > >>> >> >> >> >> >>>> Further, we need to think about how dials and other
> cctbx-based packages interact. If pip install cctbx is set up, how does
> pip install dials work, such that any dials shared libraries can find the
> cctbx libraries? Can shared libraries from one pip package link against
> libraries in another pip package? Would each package need to supply its
> own boost? Possibly this is well understood in the pip field, but not by
> me :)
> > >>> >> >> >> >> >>>> Finally, there's the option of providing a source
> pip package. This would require the full compiler toolchain for any given
> platform (macOS, linux, windows). These are likely available for
> developers, but not for general users.
> > >>> >> >> >> >> >>>> Anyway, these are some of the obstacles. Not
> saying it isn't possible, it's just a lot of effort.
> > >>> >> >> >> >> >>>> Thanks,
> > >>> >> >> >> >> >>>> -Aaron
> > >>> >> >> >> >> >>>> _______________________________________________
> > >>> >> >> >> >> >>>> cctbxbb mailing list
> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
> cctbxbb(a)phenix-online.org>
> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >>>> _______________________________________________
> > >>> >> >> >> >> >>>> cctbxbb mailing list
> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
> cctbxbb(a)phenix-online.org>
> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >>>> _______________________________________________
> > >>> >> >> >> >> >>>> cctbxbb mailing list
> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
> cctbxbb(a)phenix-online.org>
> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >>>> --
> > >>> >> >> >> >> >>>> This e-mail and any attachments may contain
> confidential, copyright and or privileged material, and are for the use of
> the intended addressee only. If you are not the intended addressee or an
> authorised recipient of the addressee please notify us of receipt by
> returning the e-mail and do not use, copy, retain, distribute or disclose
> the information in or attached to the e-mail.
> > >>> >> >> >> >> >>>> Any opinions expressed within this e-mail are those
> of the individual and not necessarily of Diamond Light Source Ltd.
> > >>> >> >> >> >> >>>> Diamond Light Source Ltd. cannot guarantee that
> this e-mail or any attachments are free from viruses and we cannot accept
> liability for any damage which you may sustain as a result of software
> viruses which may be transmitted in or with the message.
> > >>> >> >> >> >> >>>> Diamond Light Source Limited (company no. 4375679).
> Registered in England and Wales with its registered office at Diamond
> House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11
> 0DE, United Kingdom
> > >>> >> >> >> >> >>>> _______________________________________________
> > >>> >> >> >> >> >>>> cctbxbb mailing list
> > >>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org
> > >>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >>> _______________________________________________
> > >>> >> >> >> >> >>> cctbxbb mailing list
> > >>> >> >> >> >> >>> cctbxbb(a)phenix-online.org
> > >>> >> >> >> >> >>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >>
> > >>> >> >> >> >> >> _______________________________________________
> > >>> >> >> >> >> >> cctbxbb mailing list
> > >>> >> >> >> >> >> cctbxbb(a)phenix-online.org
> > >>> >> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >> >
> > >>> >> >> >> >> >
> > >>> >> >> >> >> > _______________________________________________
> > >>> >> >> >> >> > cctbxbb mailing list
> > >>> >> >> >> >> > cctbxbb(a)phenix-online.org
> > >>> >> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >>
> > >>> >> >> >> >>
> > >>> >> >> >> >> _______________________________________________
> > >>> >> >> >> >> cctbxbb mailing list
> > >>> >> >> >> >> cctbxbb(a)phenix-online.org
> > >>> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >> >
> > >>> >> >> >> > _______________________________________________
> > >>> >> >> >> > cctbxbb mailing list
> > >>> >> >> >> > cctbxbb(a)phenix-online.org
> > >>> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >>
> > >>> >> >> >>
> > >>> >> >> >>
> > >>> >> >> >> --
> > >>> >> >> >> Gergely Katona, PhD
> > >>> >> >> >> Associate Professor
> > >>> >> >> >> Department of Chemistry and Molecular Biology, University
> of Gothenburg
> > >>> >> >> >> Box 462, 40530 G?teborg, Sweden
> > >>> >> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax:
> +46-31-786-3910
> > >>> >> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
> > >>> >> >> >>
> > >>> >> >> >> _______________________________________________
> > >>> >> >> >> cctbxbb mailing list
> > >>> >> >> >> cctbxbb(a)phenix-online.org
> > >>> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >> >
> > >>> >> >> > _______________________________________________
> > >>> >> >> > cctbxbb mailing list
> > >>> >> >> > cctbxbb(a)phenix-online.org
> > >>> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >>
> > >>> >> >>
> > >>> >> >>
> > >>> >> >> --
> > >>> >> >> Gergely Katona, PhD
> > >>> >> >> Associate Professor
> > >>> >> >> Department of Chemistry and Molecular Biology, University of
> Gothenburg
> > >>> >> >> Box 462, 40530 G?teborg, Sweden
> > >>> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax:
> +46-31-786-3910
> > >>> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
> > >>> >> >>
> > >>> >> >> _______________________________________________
> > >>> >> >> cctbxbb mailing list
> > >>> >> >> cctbxbb(a)phenix-online.org
> > >>> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >> >
> > >>> >> > _______________________________________________
> > >>> >> > cctbxbb mailing list
> > >>> >> > cctbxbb(a)phenix-online.org
> > >>> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >>
> > >>> >>
> > >>> >>
> > >>> >> --
> > >>> >> Gergely Katona, PhD
> > >>> >> Associate Professor
> > >>> >> Department of Chemistry and Molecular Biology, University of
> Gothenburg
> > >>> >> Box 462, 40530 G?teborg, Sweden
> > >>> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
> > >>> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
> > >>> >>
> > >>> >> _______________________________________________
> > >>> >> cctbxbb mailing list
> > >>> >> cctbxbb(a)phenix-online.org
> > >>> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>> >
> > >>> > _______________________________________________
> > >>> > cctbxbb mailing list
> > >>> > cctbxbb(a)phenix-online.org
> > >>> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >>>
> > >>>
> > >>>
> > >>> --
> > >>> Gergely Katona, PhD
> > >>> Associate Professor
> > >>> Department of Chemistry and Molecular Biology, University of
> Gothenburg
> > >>> Box 462, 40530 G?teborg, Sweden
> > >>> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
> > >>> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
> > >>>
> > >>> _______________________________________________
> > >>> cctbxbb mailing list
> > >>> cctbxbb(a)phenix-online.org
> > >>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> > >
> > > _______________________________________________
> > > cctbxbb mailing list
> > > cctbxbb(a)phenix-online.org
> > > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
> >
> >
> >
> > --
> > Gergely Katona, Professor
> > Department of Chemistry and Molecular Biology, University of Gothenburg
> > Box 462, 40530 G?teborg, Sweden
> > Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
> > Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>
>
>
> --
> Gergely Katona, Professor
> Department of Chemistry and Molecular Biology, University of Gothenburg
> Box 462, 40530 G?teborg, Sweden
> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>
> _______________________________________________
> cctbxbb mailing list
> cctbxbb(a)phenix-online.org
> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>
2
1

21 Dec '19
By following Billy's directions and using new envs, I was able to install cctbx with conda on Mac OS 15.2
with Python 3.6, 3.7, and 3.8. I was able to run some simple scripts.
I ran the test that Billy suggested and also got 30 errors.
Best regards,
Blaine
Blaine Mooers, Ph.D.
Associate Professor
Department of Biochemistry and Molecular Biology
College of Medicine
University of Oklahoma Health Sciences Center
S.L. Young Biomedical Research Center (BRC) Rm. 466
975 NE 10th Street, BRC 466
Oklahoma City, OK 73104-5419
________________________________________
From: cctbxbb-bounces(a)phenix-online.org [cctbxbb-bounces(a)phenix-online.org] on behalf of cctbxbb-request(a)phenix-online.org [cctbxbb-request(a)phenix-online.org]
Sent: Friday, December 20, 2019 2:00 PM
To: cctbxbb(a)phenix-online.org
Subject: [EXTERNAL] cctbxbb Digest, Vol 129, Issue 6
Send cctbxbb mailing list submissions to
cctbxbb(a)phenix-online.org
To subscribe or unsubscribe via the World Wide Web, visit
https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
or, via email, send a message with subject or body 'help' to
cctbxbb-request(a)phenix-online.org
You can reach the person managing the list at
cctbxbb-owner(a)phenix-online.org
When replying, please edit your Subject line so it is more specific
than "Re: Contents of cctbxbb digest..."
Today's Topics:
1. Re: some thoughts on cctbx and pip (Billy Poon)
----------------------------------------------------------------------
Message: 1
Date: Fri, 20 Dec 2019 11:15:35 -0800
From: Billy Poon <BKPoon(a)lbl.gov>
To: cctbx mailing list <cctbxbb(a)phenix-online.org>
Subject: Re: [cctbxbb] some thoughts on cctbx and pip
Message-ID:
<CAHmYUcYdeXspPwWW2fOOBg0p734p9XYKqS-LiXXqyU-ydBu4pw(a)mail.gmail.com>
Content-Type: text/plain; charset="utf-8"
Hi everyone,
I updated the conda packages on the cctbx-dev channel and there are also
now packages for macOS. The old packages have been removed so you can
create a new environment with
conda create -n test -c cctbx-dev cctbx python=2.7
conda activate test
where "test" is the environment name and 2.7 is the python version. For the
python version, you can also pick 3.6, 3.7, or 3.8. I think the latest
conda will install 3.8 as the default python if the python argument is not
provided. Or install into an existing environment (with python already
installed) with the same command as before,
conda install -c cctbx-dev cctbx
Again, your .condarc file should have conda-forge as the first channel so
that dependencies can be pulled correctly.
The dispatchers should work now and $LIBTBX_BUILD will be set on activation
of an environment (and unset on environment deactivation) or after
installing into an existing environment, so you can do more interesting
things like
iotbx.fetch_pdb --all --mtz 1kp8
However, this package does not install databases, so
molprobity.molprobity 1kp8.pdb 1kp8.mtz
will fail because the database is not available (also probe and reduce are
not built).
Some known issues in no particular order,
1) You can run "libtbx.run_tests_parallel module=cctbx nproc=Auto" to run
tests, but not all the test files were copied, so I got 30 failures here.
The final package will probably not have the test files.
2) The other python dispatchers, like "cctbx.python", were not updated, so
those will fail. But you can just run "python" in the active environment.
3) Parts of mmtbx still need to be updated for Python 3.
4) The LIBTBX_BUILD variable should be set for sh and csh shells. Let me
know if it's not working for your shell (i.e. "echo $LIBTBX_BUILD" should
show the same thing as $CONDA_PREFIX).
5) One future step is to enable building other CCTBX-like modules with this
conda package. This will require some bookkeeping updates so that modules
in the conda environment and the modules being built are tracked properly.
Also, making sure that all the necessary headers exist in $PREFIX/include.
Gergely, let me know if your scripts are working.
Happy holidays!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
On Wed, Dec 18, 2019 at 11:25 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
> Hi Gergely,
>
> That's the other information that hasn't been updated yet in the conda
> package. :)
>
> For LIBTBX_BUILD, I can set up environment variables sort of how the conda
> gcc package sets up environment variables. I have to double check to see if
> they're set after installation of the package and after activation of an
> environment. The variable will just be a copy of $CONDA_PREFIX.
>
> The libtbx_env file is a file that exists in $LIBTBX_BUILD that basically
> stores configuration information. I'll have to modify the contents to
> update the locations of the different modules since the conda package will
> not have a "modules" directory.
>
> --
> Billy K. Poon
> Research Scientist, Molecular Biophysics and Integrated Bioimaging
> Lawrence Berkeley National Laboratory
> 1 Cyclotron Road, M/S 33R0345
> Berkeley, CA 94720
> Tel: (510) 486-5709
> Fax: (510) 486-5909
> Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>
>
> On Wed, Dec 18, 2019 at 2:08 AM Gergely Katona <gkatona(a)gmail.com> wrote:
>
>> Hi Billy,
>>
>> Conda install went fine with your instructions after rearranging the
>> channels by putting cctbx last. I removed all environmental variables
>> and previous build of cctbx.
>>
>> import sys
>> print (sys.path, sys.prefix)
>>
>> ['/home/gergely/anaconda3/lib/https://urldefense.proofpoint.com/v2/url?u=http-3A__python36.zip&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ST4siK2y7PNpS4anr425eXK4FO6ig7oA-XNHoaHgCpY&e= ',
>> '/home/gergely/anaconda3/lib/python3.6',
>> '/home/gergely/anaconda3/lib/python3.6/lib-dynload', '',
>> '/home/gergely/anaconda3/lib/python3.6/site-packages',
>> '/home/gergely/anaconda3/lib/python3.6/site-packages/IPython/extensions',
>> '/home/gergely/.ipython'] /home/gergely/anaconda3
>>
>> Many imports went fine including pymc3, but I encountered problems
>> with these three:
>>
>> from cctbx import miller
>> import iotbx.pdb
>> from iotbx import reflection_file_reader, mtz
>>
>>
>> I also got type error when handling space groups.
>>
>>
>>
>>
>> ---------------------------------------------------------------------------
>> KeyError Traceback (most recent call
>> last)
>> <ipython-input-5-cedbd4f84f3d> in <module>
>> 25 from cctbx import uctbx
>> 26 from cctbx import sgtbx
>> ---> 27 from cctbx import miller
>> 28 #from iotbx import reflection_file_reader, mtz
>> 29 sns.set_context("poster")
>>
>> ~/anaconda3/lib/python3.6/site-packages/cctbx/miller/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ou8J8HxatN0TDK1PJ-GUgX9YcOgS5Fayhbs61Wt2f7g&e= in
>> <module>
>> 11
>> 12 from cctbx import crystal
>> ---> 13 from cctbx import maptbx
>> 14 from cctbx import sgtbx
>> 15 from cctbx.sgtbx import lattice_symmetry
>>
>> ~/anaconda3/lib/python3.6/site-packages/cctbx/maptbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ou8J8HxatN0TDK1PJ-GUgX9YcOgS5Fayhbs61Wt2f7g&e= in
>> <module>
>> 15 from libtbx import adopt_init_args
>> 16 from libtbx.utils import Sorry
>> ---> 17 import libtbx.load_env
>> 18 import math
>> 19 import sys, os
>>
>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=dUMVNgDtesLENoxBTvPr4XX4mczuZIsmZzdOmPlGbtI&e= in <module>
>> 3 import libtbx.env_config
>> 4 import os
>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
>> 6 libtbx.env.set_os_environ_all_dist()
>> 7 libtbx.env.dispatcher_name =
>> os.environ.get("LIBTBX_DISPATCHER_NAME")
>>
>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=2BeTV_6Dw8q_ulzvyRBt0YhebeaqhUvm-em6GAOEaI4&e= in unpickle()
>> 2603
>> 2604 def unpickle():
>> -> 2605 build_path = os.environ["LIBTBX_BUILD"]
>> 2606
>> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
>> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
>>
>> ~/anaconda3/lib/python3.6/https://urldefense.proofpoint.com/v2/url?u=http-3A__os.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=y6dOvVLcNHYw8pJU1uwOEPGTH8lLyIp-mgtyv_X2bFQ&e= in __getitem__(self, key)
>> 667 except KeyError:
>> 668 # raise KeyError with the original key value
>> --> 669 raise KeyError(key) from None
>> 670 return self.decodevalue(value)
>> 671
>>
>> KeyError: 'LIBTBX_BUILD'
>>
>>
>>
>>
>> ---------------------------------------------------------------------------
>> ArgumentError Traceback (most recent call
>> last)
>> <ipython-input-7-2acd3a9ce26a> in <module>
>> 26 return
>> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar
>> 27
>> ---> 28
>> ms,msnam,mscent,msacent,msnamacent,msnamcent,msnamacent_dstar=initializecrystal()
>>
>> <ipython-input-7-2acd3a9ce26a> in initializecrystal()
>> 11 uc = uctbx.unit_cell(unit_cell)
>> 12 wavelength = 1.54980
>> ---> 13 xtal_symm = crystal.symmetry(unit_cell=unit_cell,
>> space_group_symbol="P 43 21 2")
>> 14
>> 15 ms =
>> miller.build_set(crystal_symmetry=xtal_symm,anomalous_flag=True,
>> d_min=1.61)
>>
>> ~/anaconda3/lib/python3.6/site-packages/cctbx/crystal/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ou8J8HxatN0TDK1PJ-GUgX9YcOgS5Fayhbs61Wt2f7g&e= in
>> __init__(self, unit_cell, space_group_symbol, space_group_info,
>> space_group, correct_rhombohedral_setting_if_necessary,
>> assert_is_compatible_unit_cell, raise_sorry_if_incompatible_unit_cell,
>> force_compatible_unit_cell)
>> 74 if (space_group_symbol is not None):
>> 75 self._space_group_info = sgtbx.space_group_info(
>> ---> 76 symbol=space_group_symbol)
>> 77 elif (space_group is not None):
>> 78 if (isinstance(space_group, sgtbx.space_group)):
>>
>> ~/anaconda3/lib/python3.6/site-packages/cctbx/sgtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ou8J8HxatN0TDK1PJ-GUgX9YcOgS5Fayhbs61Wt2f7g&e= in
>> __init__(self, symbol, table_id, group, number, space_group_t_den)
>> 100 assert group is None
>> 101 if (table_id is None):
>> --> 102 symbols = space_group_symbols(symbol)
>> 103 else:
>> 104 if (isinstance(symbol, int)): symbol = str(symbol)
>>
>> ArgumentError: Python argument types in
>> space_group_symbols.__init__(space_group_symbols, str)
>> did not match C++ signature:
>> __init__(_object*, int space_group_number)
>> __init__(_object*, int space_group_number,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > extension='')
>> __init__(_object*, int space_group_number,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > extension='', std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > table_id='')
>> __init__(_object*, std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > symbol)
>> __init__(_object*, std::__cxx11::basic_string<char,
>> std::char_traits<char>, std::allocator<char> > symbol,
>> std::__cxx11::basic_string<char, std::char_traits<char>,
>> std::allocator<char> > table_id='')
>>
>>
>> When I tried to set LIBTBX_BUILD to /home/gergely/anaconda3 (this is
>> sys.prefix on my system), I got other problems when importing. Can
>> LIBTBX_BUILD be set in the conda package?
>>
>>
>>
>>
>> ---------------------------------------------------------------------------
>> FileNotFoundError Traceback (most recent call
>> last)
>> <ipython-input-1-7e2b144826cc> in <module>
>> 26 from cctbx import sgtbx
>> 27 #from cctbx import miller
>> ---> 28 from iotbx import reflection_file_reader, mtz
>> 29 sns.set_context("poster")
>> 30 plt.rcParams.update({'figure.autolayout': True})
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__reflection-5Ffile-5Freader.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=yYMogebnDLYk0-5LYB00qDeyEYddmSEzic2HY01p1-4&e=
>> in <module>
>> 53
>> 54 from __future__ import absolute_import, division, print_function
>> ---> 55 from iotbx import mtz
>> 56 from iotbx.scalepack import merge as scalepack_merge
>> 57 from iotbx.scalepack import no_merge_original_index as
>> scalepack_no_merge
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__-5F-5Finit-5F-5F.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=ou8J8HxatN0TDK1PJ-GUgX9YcOgS5Fayhbs61Wt2f7g&e= in <module>
>> 9 import iotbx_mtz_ext as ext
>> 10
>> ---> 11 from iotbx.mtz import extract_from_symmetry_lib
>> 12 from cctbx import xray
>> 13 import cctbx.xray.observation_types
>>
>>
>> ~/anaconda3/lib/python3.6/site-packages/iotbx/mtz/https://urldefense.proofpoint.com/v2/url?u=http-3A__extract-5Ffrom-5Fsymmetry-5Flib.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=sdo4JC4HEfj-rC7w_ahWQIcYyaTeKakuavIvEeWWbf8&e=
>> in <module>
>> 1 from __future__ import absolute_import, division, print_function
>> 2 from cctbx import sgtbx
>> ----> 3 import libtbx.load_env
>> 4 import os.path as op
>> 5 from six.moves import range
>>
>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__load-5Fenv.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=dUMVNgDtesLENoxBTvPr4XX4mczuZIsmZzdOmPlGbtI&e= in <module>
>> 3 import libtbx.env_config
>> 4 import os
>> ----> 5 libtbx.env = libtbx.env_config.unpickle()
>> 6 libtbx.env.set_os_environ_all_dist()
>> 7 libtbx.env.dispatcher_name =
>> os.environ.get("LIBTBX_DISPATCHER_NAME")
>>
>> ~/anaconda3/lib/python3.6/site-packages/libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&d=DwICAg&c=VjzId-SM5S6aVB_cCGQ0d3uo9UfKByQ3sI6Audoy6dY&r=k0gMbcsdOcdbPUNV5tW66KQSZfXL0ewVDPVBp7tqbks&m=XYalX3Fy1IGs4p_M1YHMvPXXo6HJximT9mf_zMIckxU&s=2BeTV_6Dw8q_ulzvyRBt0YhebeaqhUvm-em6GAOEaI4&e= in unpickle()
>> 2605 build_path = os.environ["LIBTBX_BUILD"]
>> 2606
>> set_preferred_sys_prefix_and_sys_executable(build_path=build_path)
>> -> 2607 libtbx_env = open(op.join(build_path, "libtbx_env"), "rb")
>> 2608 env = pickle.load(libtbx_env)
>> 2609 if (env.python_version_major_minor != sys.version_info[:2]):
>>
>> FileNotFoundError: [Errno 2] No such file or directory:
>> '/home/gergely/anaconda3/libtbx_env'
>>
>> On Wed, Dec 18, 2019 at 9:10 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> >
>> > Hi Gergely,
>> >
>> > I've uploaded linux packages to a new channel, cctbx-dev, and you can
>> install it with
>> >
>> > conda install -c cctbx-dev cctbx
>> >
>> > in your current environment. You should set your ~/.condarc file to
>> pull the other dependencies from the conda-forge channel first, so put
>> conda-forge above cctbx. Mine looks like
>> >
>> > channels:
>> > - conda-forge
>> > - defaults
>> > - cctbx
>> >
>> > Do you need dxtbx for your scripts? This package does not build that
>> part. I think the plan is to build a separate conda package for dxtbx so
>> that it can be updated more frequently. I can rebuild the packages to
>> include it for testing, but the one being submitted to conda-forge will not
>> have it.
>> >
>> > Also, your error message is probably due to version of HDF5 that the
>> development build installs. The https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… script will install 1.10.4,
>> but your other dependency is looking for 1.10.5. Installing this cctbx
>> conda package should install 1.10.5, which should fix the issue. Also, I'm
>> updating those environments and 1.10.5 will be the new default version.
>> >
>> > Lastly, the dispatchers will not work in these packages because the old
>> paths during the build process are still in them and many of them expect
>> some additional information that has not been updated in the packages yet.
>> I'm in the process of doing that and will update the cctbx-dev channel when
>> that's done. However, by starting python, you can import cctbx modules. So
>> you can run commands like
>> >
>> > from scitbx.array_family import flex
>> > a = flex.random_double(1000000)
>> > b = flex.min_max_mean_double(a)
>> > b.min
>> > b.max
>> > b.mean
>> >
>> > Thanks!
>> >
>> > --
>> > Billy K. Poon
>> > Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> > Lawrence Berkeley National Laboratory
>> > 1 Cyclotron Road, M/S 33R0345
>> > Berkeley, CA 94720
>> > Tel: (510) 486-5709
>> > Fax: (510) 486-5909
>> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> >
>> >
>> > On Tue, Dec 17, 2019 at 5:39 AM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> >>
>> >> Dear Billy,
>> >>
>> >> Thank you for the detailed explanation, I look forward to do further
>> >> testing! I aim to pool all modules under the same environment, if
>> >> there are conflicts then I just try to reshuffle the order of imports.
>> >> So far this did not cause problems for me even when I was using system
>> >> python, but of course it is not the most prudent thing to do. With
>> >> anaconda everything is much more standardized and isolated already and
>> >> without being superuser I can have my familiar environment at any
>> >> synchrotron based cluster. It is great that cctbx will be an integral
>> >> part of this ecosystem and this was also the last thing holding me
>> >> back from adopting python3. About hdf5, pymc3 requires it and
>> >> importing causes a kernel restart with the following error messages,
>> >> curiously if I import h5py first this can be avoided.
>> >>
>> >> Best wishes,
>> >>
>> >> Gergely
>> >>
>> >> import pymc3 as pm
>> >>
>> >> Warning! ***HDF5 library version mismatched error***
>> >> The HDF5 header files used to compile this application do not match
>> >> the version used by the HDF5 library to which this application is
>> linked.
>> >> Data corruption or segmentation faults may occur if the application
>> continues.
>> >> This can happen when an application was compiled by one version of
>> HDF5 but
>> >> linked with a different version of static or shared HDF5 library.
>> >> You should recompile the application or check your shared library
>> related
>> >> settings such as 'LD_LIBRARY_PATH'.
>> >> You can, at your own risk, disable this warning by setting the
>> environment
>> >> variable 'HDF5_DISABLE_VERSION_CHECK' to a value of '1'.
>> >> Setting it to 2 or higher will suppress the warning messages totally.
>> >> Headers are 1.10.4, library is 1.10.5
>> >> SUMMARY OF THE HDF5 CONFIGURATION
>> >> =================================
>> >>
>> >> General Information:
>> >> -------------------
>> >> HDF5 Version: 1.10.5
>> >> Configured on: Tue Oct 22 12:02:13 UTC 2019
>> >> Configured by: conda@16247e67ecd5
>> >> Host system: x86_64-conda_cos6-linux-gnu
>> >> Uname information: Linux 16247e67ecd5 4.15.0-1059-azure
>> >> #64-Ubuntu SMP Fri Sep 13 17:02:44 UTC 2019 x86_64 x86_64 x86_64
>> >> GNU/Linux
>> >> Byte sex: little-endian
>> >> Installation point: /home/gergely/anaconda3
>> >>
>> >> Compiling Options:
>> >> ------------------
>> >> Build Mode: production
>> >> Debugging Symbols: no
>> >> Asserts: no
>> >> Profiling: no
>> >> Optimization Level: high
>> >>
>> >> Linking Options:
>> >> ----------------
>> >> Libraries: static, shared
>> >> Statically Linked Executables:
>> >> LDFLAGS: -Wl,-O2 -Wl,--sort-common
>> >> -Wl,--as-needed -Wl,-z,relro -Wl,-z,now -Wl,--disable-new-dtags
>> >> -Wl,--gc-sections -Wl,-rpath,/home/gergely/anaconda3/lib
>> >> -Wl,-rpath-link,/home/gergely/anaconda3/lib
>> >> -L/home/gergely/anaconda3/lib
>> >> H5_LDFLAGS:
>> >> AM_LDFLAGS: -L/home/gergely/anaconda3/lib
>> >> Extra libraries: -lrt -lpthread -lz -ldl -lm
>> >> Archiver:
>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ar
>> >> AR_FLAGS: cr
>> >> Ranlib:
>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-ranlib
>> >>
>> >> Languages:
>> >> ----------
>> >> C: yes
>> >> C Compiler:
>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-cc
>> >> CPPFLAGS: -DNDEBUG -D_FORTIFY_SOURCE=2 -O2
>> >> -I/home/gergely/anaconda3/include
>> >> H5_CPPFLAGS: -D_GNU_SOURCE
>> >> -D_POSIX_C_SOURCE=200809L -DNDEBUG -UH5_DEBUG_API
>> >> AM_CPPFLAGS: -I/home/gergely/anaconda3/include
>> >> C Flags: -march=nocona -mtune=haswell
>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
>> >>
>> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
>> >> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
>> >> H5 C Flags: -std=c99 -pedantic -Wall -Wextra
>> >> -Wbad-function-cast -Wc++-compat -Wcast-align -Wcast-qual -Wconversion
>> >> -Wdeclaration-after-statement -Wdisabled-optimization -Wfloat-equal
>> >> -Wformat=2 -Winit-self -Winvalid-pch -Wmissing-declarations
>> >> -Wmissing-include-dirs -Wmissing-prototypes -Wnested-externs
>> >> -Wold-style-definition -Wpacked -Wpointer-arith -Wredundant-decls
>> >> -Wshadow -Wstrict-prototypes -Wswitch-default -Wswitch-enum -Wundef
>> >> -Wunused-macros -Wunsafe-loop-optimizations -Wwrite-strings
>> >> -finline-functions -s -Wno-inline -Wno-aggregate-return
>> >> -Wno-missing-format-attribute -Wno-missing-noreturn -O
>> >> AM C Flags:
>> >> Shared C Library: yes
>> >> Static C Library: yes
>> >>
>> >>
>> >> Fortran: yes
>> >> Fortran Compiler:
>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-gfortran
>> >> Fortran Flags:
>> >> H5 Fortran Flags: -pedantic -Wall -Wextra -Wunderflow
>> >> -Wimplicit-interface -Wsurprising -Wno-c-binding-type -s -O2
>> >> AM Fortran Flags:
>> >> Shared Fortran Library: yes
>> >> Static Fortran Library: yes
>> >>
>> >> C++: yes
>> >> C++ Compiler:
>> >>
>> /home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/_build_env/bin/x86_64-conda_cos6-linux-gnu-c++
>> >> C++ Flags: -fvisibility-inlines-hidden
>> >> -std=c++17 -fmessage-length=0 -march=nocona -mtune=haswell
>> >> -ftree-vectorize -fPIC -fstack-protector-strong -fno-plt -O2
>> >> -ffunction-sections -pipe -I/home/gergely/anaconda3/include
>> >>
>> -fdebug-prefix-map=/home/conda/feedstock_root/build_artifacts/hdf5_split_1571745596770/work=/usr/local/src/conda/hdf5_split-1.10.5
>> >> -fdebug-prefix-map=/home/gergely/anaconda3=/usr/local/src/conda-prefix
>> >> H5 C++ Flags: -pedantic -Wall -W -Wundef -Wshadow
>> >> -Wpointer-arith -Wcast-qual -Wcast-align -Wwrite-strings -Wconversion
>> >> -Wredundant-decls -Winline -Wsign-promo -Woverloaded-virtual
>> >> -Wold-style-cast -Weffc++ -Wreorder -Wnon-virtual-dtor
>> >> -Wctor-dtor-privacy -Wabi -finline-functions -s -O
>> >> AM C++ Flags:
>> >> Shared C++ Library: yes
>> >> Static C++ Library: yes
>> >>
>> >> Java: no
>> >>
>> >>
>> >> Features:
>> >> ---------
>> >> Parallel HDF5: no
>> >> Parallel Filtered Dataset Writes: no
>> >> Large Parallel I/O: no
>> >> High-level library: yes
>> >> Threadsafety: yes
>> >> Default API mapping: v110
>> >> With deprecated public symbols: yes
>> >> I/O filters (external): deflate(zlib)
>> >> MPE: no
>> >> Direct VFD: no
>> >> dmalloc: no
>> >> Packages w/ extra debug output: none
>> >> API tracing: no
>> >> Using memory checker: yes
>> >> Memory allocation sanity checks: no
>> >> Function stack tracing: no
>> >> Strict file format checks: no
>> >> Optimization instrumentation: no
>> >>
>> >> On Tue, Dec 17, 2019 at 8:35 AM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> >> >
>> >> > Hi Gergely,
>> >> >
>> >> > Let me build the test package tomorrow. All the gritty details for
>> building with conda is being finalized and the official documentation will
>> be updated to describe the steps. It would be too confusing to keep
>> changing the documentation as the process evolves. You do have the general
>> process, though, which is summarized as follows.
>> >> >
>> >> > 1) Installing dependencies. The cctbx_dependencies metapackage was
>> an initial approach for managing the CCTBX dependencies, but after
>> contacting the conda-forge folks, they recommended using the --only-deps
>> flag. So when the CCTBX conda package is available, you'll be able to get a
>> set of dependencies with,
>> >> >
>> >> > conda install -c conda-forge --only-deps cctbx
>> >> >
>> >> > By default, the https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file will automatically install a set
>> of dependencies in the "conda_base" directory (and a conda installation if
>> one is not found). It just uses standard conda environment files located in
>> libtbx/auto_build/conda_envs, so you do not need to install
>> cctbx_dependencies as a separate step. The environment files avoid channel
>> issues by explicitly defining the channel to pull the packages from and the
>> cctbx channel just stores copies of packages from conda-forge. There were
>> issues earlier where the conda-forge packages would sometimes be moved to a
>> different label. The --use-conda flag also accepts a path to $CONDA_PREFIX
>> if you want to use a specific environment for testing.
>> >> >
>> >> > 2) Building. The https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… file handles that with SCons.
>> >> >
>> >> > 3) Running. After building, there should be a https://urldefense.proofpoint.com/v2/url?u=http-3A__setpaths.sh&d=DwICAg&c=… (and .csh)
>> file that adds build/bin to your path. The build/bin directory has our
>> dispatchers, which are just scripts that set up the environment variables
>> for you. This prevents other programs from loading our libraries, whose
>> versions may conflict. You should see that there is a "python" dispatcher,
>> which is a convenience for developers. Otherwise, you can use
>> libtbx.python, which will be able to import CCTBX modules.
>> >> >
>> >> > The running part is where the conda package for CCTBX will be
>> different than this build. Since our Python files and extensions modules
>> will be in the "site-packages" directory for Python, the PYTHONPATH
>> variable will not be needed (and conda suggests that that variable not be
>> set). The other CCTBX libraries will be in $CONDA_PREFIX/lib, so
>> LD_LIBRARY_PATH is not needed. In an active environment, PATH will already
>> be modified. And then our LIBTBX_BUILD directory can be set to sys.prefix.
>> >> >
>> >> > So with the conda package, you would only need to activate your
>> conda environment and CCTBX should integrate with other conda packages.
>> What is the conflict with hdf5? That's something that should be fixed.
>> Thanks!
>> >> >
>> >> > --
>> >> > Billy K. Poon
>> >> > Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> >> > Lawrence Berkeley National Laboratory
>> >> > 1 Cyclotron Road, M/S 33R0345
>> >> > Berkeley, CA 94720
>> >> > Tel: (510) 486-5709
>> >> > Fax: (510) 486-5909
>> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> >> >
>> >> >
>> >> > On Mon, Dec 16, 2019 at 2:53 AM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> >> >>
>> >> >> Dear Billy,
>> >> >>
>> >> >> Thank you for this update and for your efforts! I found a solution
>> and
>> >> >> indeed most things already work in anaconda3. The steps I took (even
>> >> >> if these instructions will have short expiry date):
>> >> >>
>> >> >> Modified .condarc with:
>> >> >> channels:
>> >> >> - cctbx
>> >> >> - conda-forge
>> >> >> - defaults
>> >> >>
>> >> >> run
>> >> >> conda conda install cctbx_dependencies python=3.6
>> >> >>
>> >> >> I expect this will work without python=3.6 in the near future.
>> >> >>
>> >> >> Then compiling cctbx with anaconda3 python went without any problem
>> >> >> when using these flags:
>> >> >> python https://urldefense.proofpoint.com/v2/url?u=http-3A__bootstrap.py&d=DwICAg&c… --use-conda --python3 --nproc=12
>> >> >>
>> >> >> Then I probably did the unorthodox thing and sourced these
>> directories:
>> >> >>
>> >> >> setenv LIBTBX_BUILD /home/gergely/cctbx/build
>> >> >> setenv PATH ${PATH}:/home/gergely/cctbx/build/bin
>> >> >> setenv PYTHONPATH
>> >> >>
>> /home/gergely/cctbx/modules/cctbx_project:/home/gergely/cctbx/modules:/home/gergely/cctbx/modules/cctbx_project/boost_adaptbx:/home/gergely/cctbx/build/lib:/home/gergely/cctbx/conda_base/lib/python3.6/site-packages:$PYTHONPATH
>> >> >> setenv LD_LIBRARY_PATH
>> >> >>
>> /home/gergely/cctbx/conda_base/lib:/home/gergely/cctbx/build/lib:$LD_LIBRARY_PATH
>> >> >>
>> >> >> There is probably a better way to put this into conda environment.
>> >> >> With these steps I could run one of my scripts depending on cctbx.
>> The
>> >> >> only problem I found is that hdf5 library had conflict with another
>> >> >> package in conda, but I does not find this as a showstopper.
>> >> >>
>> >> >> Best wishes,
>> >> >>
>> >> >> Gergely
>> >> >>
>> >> >>
>> >> >>
>> >> >>
>> >> >>
>> >> >>
>> >> >> On Fri, Dec 13, 2019 at 7:23 PM Billy Poon <BKPoon(a)lbl.gov> wrote:
>> >> >> >
>> >> >> > Hi Gergely,
>> >> >> >
>> >> >> > It's still a work in progress. I'm sorting out some Windows
>> issues right now. I can probably build a test package on a separate channel
>> for people that want to test it (let's say next week?). I'll provide
>> instructions, but basically, the test conda package will be in its own
>> separate channel and the dependencies will be pulled from the conda-forge
>> channel. I want most things to be working correctly on Python 2.7, 3.6,
>> 3.7, and 3.8 on all 3 platforms.
>> >> >> >
>> >> >> > Thanks!
>> >> >> >
>> >> >> > --
>> >> >> > Billy K. Poon
>> >> >> > Research Scientist, Molecular Biophysics and Integrated Bioimaging
>> >> >> > Lawrence Berkeley National Laboratory
>> >> >> > 1 Cyclotron Road, M/S 33R0345
>> >> >> > Berkeley, CA 94720
>> >> >> > Tel: (510) 486-5709
>> >> >> > Fax: (510) 486-5909
>> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> >> >> >
>> >> >> >
>> >> >> > On Fri, Dec 13, 2019 at 5:44 AM Gergely Katona <gkatona(a)gmail.com>
>> wrote:
>> >> >> >>
>> >> >> >> Dear Billy,
>> >> >> >>
>> >> >> >> This sounds very promising and exciting. I am not sure if cctbx
>> is
>> >> >> >> already functional as a conda package in anaconda3 (Linux) or
>> this is
>> >> >> >> still work in progress. My technical expertise does not allow me
>> to
>> >> >> >> tell the difference. What I tried:
>> >> >> >>
>> >> >> >> Fresh install of anaconda3. Adding - cctbx and - conda-forge to
>> >> >> >> .condarc . Installing pyside2 with conda. Running conda install
>> >> >> >> conda_dependencies . I get a lot package version conflict, and I
>> >> >> >> cannot import cctbx or iotbx to anaconda python. Am I following
>> the
>> >> >> >> right instructions? Or it is too early to expect that cctbx
>> works when
>> >> >> >> installed through conda?
>> >> >> >>
>> >> >> >> Best wishes,
>> >> >> >>
>> >> >> >> Gergely
>> >> >> >>
>> >> >> >> On Wed, Nov 27, 2019 at 3:56 PM Billy Poon <BKPoon(a)lbl.gov>
>> wrote:
>> >> >> >> >
>> >> >> >> > Hi all,
>> >> >> >> >
>> >> >> >> > For a brief update, I have submitted a recipe for cctbxlite to
>> conda-forge (https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_conda-2Dfor… )
>> and support for Python 3.7 and 3.8 is being added (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx… ). With some fixes for
>> Windows (https://urldefense.proofpoint.com/v2/url?u=https-3A__github.com_cctbx_cctbx… ), all platforms
>> (macOS, linux, and Windows) can build for Python 2.7, 3.6, 3.7, and 3.8.
>> Some additional changes will be needed to get Windows to work with Python 3
>> and for tests to pass with Boost 1.70.0. That will enable the conda-forge
>> recipe to build for all platforms and for all supported versions of Python.
>> >> >> >> >
>> >> >> >> > Currently, the conda-forge recipe will install into the conda
>> python and cctbx imports can be done without sourcing the environment
>> scripts. It looks like a lot of the environment variables being set in the
>> dispatchers can be removed since the Python files and C++ extensions are in
>> the right places. I'll update the libtbx_env file so that commands that
>> load the environment can work correctly.
>> >> >> >> >
>> >> >> >> > --
>> >> >> >> > Billy K. Poon
>> >> >> >> > Research Scientist, Molecular Biophysics and Integrated
>> Bioimaging
>> >> >> >> > Lawrence Berkeley National Laboratory
>> >> >> >> > 1 Cyclotron Road, M/S 33R0345
>> >> >> >> > Berkeley, CA 94720
>> >> >> >> > Tel: (510) 486-5709
>> >> >> >> > Fax: (510) 486-5909
>> >> >> >> > Web: https://urldefense.proofpoint.com/v2/url?u=https-3A__phenix-2Donline.org&d=…
>> >> >> >> >
>> >> >> >> >
>> >> >> >> > On Sun, Aug 25, 2019 at 2:33 PM Tristan Croll <tic20(a)cam.ac.uk>
>> wrote:
>> >> >> >> >>
>> >> >> >> >> Hi Luc,
>> >> >> >> >>
>> >> >> >> >> That sounds promising. From there, I?d need to work out how
>> to make a fully-packaged installer (basically a modified wheel file) for
>> the ChimeraX ToolShed - the aim is for the end user to not have to worry
>> about any of this. That adds a couple of complications - e.g. $LIBTBX_BUILD
>> would need to be set dynamically before first import - but doesn?t seem
>> insurmountable.
>> >> >> >> >>
>> >> >> >> >> Thanks,
>> >> >> >> >>
>> >> >> >> >> Tristan
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >> Tristan Croll
>> >> >> >> >> Research Fellow
>> >> >> >> >> Cambridge Institute for Medical Research
>> >> >> >> >> University of Cambridge CB2 0XY
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >> > On 25 Aug 2019, at 18:31, Luc Bourhis <
>> luc_j_bourhis(a)mac.com> wrote:
>> >> >> >> >> >
>> >> >> >> >> > Hi Tristan,
>> >> >> >> >> >
>> >> >> >> >> > cctbx could be built to use your ChimeraX python, now that
>> cctbx is moving to Python 3. The option ?with-python is there for that with
>> the bootstrap script. The specific environment setup boil down to setting
>> two environment variable LIBTBX_BUILD and either LD_LIBRARY_PATH on Linux,
>> PATH on Win32, or DYLIB_LIBRARY_PATH on MacOS. If you work within a
>> framework such as ChimeraX, that should not be difficult to ensure those
>> two variables are set.
>> >> >> >> >> >
>> >> >> >> >> > Best wishes,
>> >> >> >> >> >
>> >> >> >> >> > Luc
>> >> >> >> >> >
>> >> >> >> >> >
>> >> >> >> >> >> On 23 Aug 2019, at 19:02, Tristan Croll <tic20(a)cam.ac.uk>
>> wrote:
>> >> >> >> >> >>
>> >> >> >> >> >> To add my two cents on this: probably the second-most
>> common question I've had about ISOLDE's implementation is, "why didn't you
>> use CCTBX?". The honest answer to that is, "I didn't know how."
>> >> >> >> >> >>
>> >> >> >> >> >> Still don't, really - although the current developments
>> are rather promising. The problem I've faced is that CCTBX was designed as
>> its own self-contained Python (2.7, until very recently) environment, with
>> its own interpreter and a lot of very specific environment setup. Meanwhile
>> I'm developing ISOLDE in ChimeraX, which is *also* its own self-contained
>> Python (3.7) environment. To plug one into the other in that form... well,
>> I don't think I'm a good enough programmer to really know where to start.
>> >> >> >> >> >>
>> >> >> >> >> >> The move to Conda and a more modular CCTBX architecture
>> should make a lot more possible in that direction. Pip would be even better
>> for me personally (ChimeraX can install directly from the PyPI, but doesn't
>> interact with Conda) - but I understand pretty well the substantial
>> challenge that would amount to (not least being that the PyPI imposes a
>> limit - around 100MB from memory? - on the size of an individual package).
>> >> >> >> >> >>
>> >> >> >> >> >> Best regards,
>> >> >> >> >> >>
>> >> >> >> >> >> Tristan
>> >> >> >> >> >>
>> >> >> >> >> >>> On 2019-08-23 09:28, Luc Bourhis wrote:
>> >> >> >> >> >>> Hi Graeme,
>> >> >> >> >> >>> Yes, I know. But ?black" is a program doing a very
>> particular task
>> >> >> >> >> >>> (code formatting from the top of my head). Requiring to
>> use a wrapper
>> >> >> >> >> >>> for python itself is another level. But ok, I think I am
>> mellowing to
>> >> >> >> >> >>> the idea after all! Talking with people around me, and
>> extrapolating,
>> >> >> >> >> >>> I would bet that, right now, a great majority of people
>> interested by
>> >> >> >> >> >>> cctbx in pip have already used the cctbx, so they know
>> about the
>> >> >> >> >> >>> Python wrapper, and they would not be too sanguine about
>> that. My
>> >> >> >> >> >>> concern is for the future, when pip will be the first
>> time some people
>> >> >> >> >> >>> use cctbx. Big fat warning notices on PyPI page and a
>> better error
>> >> >> >> >> >>> message when cctbx fails because LIBTBX_BUILD is not set
>> would be
>> >> >> >> >> >>> needed but that could be all right.
>> >> >> >> >> >>> If we do a pip installer, we should aim at a minimal
>> install: cctbx,
>> >> >> >> >> >>> iotbx and their dependencies, and that?s it.
>> >> >> >> >> >>> Best wishes,
>> >> >> >> >> >>> Luc
>> >> >> >> >> >>>> On 23 Aug 2019, at 07:17, Graeme.Winter(a)Diamond.ac.uk <
>> Graeme.Winter(a)diamond.ac.uk> wrote:
>> >> >> >> >> >>>> Without discussing the merits of this or whether we
>> _choose_ to make the move to supporting PIP, I am certain it would be
>> _possible_ - many other packages make dispatcher scripts when you pip
>> install them e.g.
>> >> >> >> >> >>>> Silver-Surfer rescale_f2 :) $ which black; cat $(which
>> black)
>> >> >> >> >> >>>>
>> /Library/Frameworks/Python.framework/Versions/3.6/bin/black
>> >> >> >> >> >>>>
>> #!/Library/Frameworks/Python.framework/Versions/3.6/bin/python3.6
>> >> >> >> >> >>>> # -*- coding: utf-8 -*-
>> >> >> >> >> >>>> import re
>> >> >> >> >> >>>> import sys
>> >> >> >> >> >>>> from black import main
>> >> >> >> >> >>>> if __name__ == '__main__':
>> >> >> >> >> >>>> sys.argv[0] = re.sub(r'(-script\.pyw?|\.exe)?$', '',
>> sys.argv[0])
>> >> >> >> >> >>>> sys.exit(main())
>> >> >> >> >> >>>> So we _could_ work around the absence of LIBTBX_BUILD
>> etc. in the system. Whether or not we elect to do the work is a different
>> question, and it seems clear that here are very mixed opinions on this.
>> >> >> >> >> >>>> Best wishes Graeme
>> >> >> >> >> >>>> On 23 Aug 2019, at 01:21, Luc Bourhis <
>> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
>> >> >> >> >> >>>> Hi,
>> >> >> >> >> >>>> Even if we managed to ship our the boost dynamic
>> libraries with pip, it would still not be pip-like, as we would still need
>> our python wrappers to set LIBTBX_BUILD and LD_LIBRARY_PATH. Normal pip
>> packages work with the standard python exe. LD_LIBRARY_PATH, we could get
>> around that by changing the way we compile, using -Wl,-R, which is the
>> runtime equivalent of build time -L. That?s a significant change that would
>> need to be tested. But there is no way around setting LIBTBX_BUILD right
>> now. Leaving that to the user is horrible. Perhaps there is a way to hack
>> libtbx/https://urldefense.proofpoint.com/v2/url?u=http-3A__env-5Fconfig.py&… so that we can hardwire LIBTBX_BUILD in there when pip
>> installs?
>> >> >> >> >> >>>> Best wishes,
>> >> >> >> >> >>>> Luc
>> >> >> >> >> >>>> On 16 Aug 2019, at 22:47, Luc Bourhis <
>> luc_j_bourhis(a)mac.com<mailto:[email protected]>> wrote:
>> >> >> >> >> >>>> Hi,
>> >> >> >> >> >>>> I did look into that many years ago, and even toyed with
>> building a pip installer. What stopped me is the exact conclusion you
>> reached too: the user would not have the pip experience he expects. You are
>> right that it is a lot of effort but is it worth it? Considering that
>> remark, I don?t think so. Now, Conda was created specifically to go beyond
>> pip pure-python-only support. Since cctbx has garnered support for Conda,
>> the best avenue imho is to go the extra length to have a package on
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__Anaconda.org&d=DwICAg&c… <https://urldefense.proofpoint.com/v2/url?u=http-3A__anaconda.org_&d=DwICAg&… >, and then to advertise it hard to
>> every potential user out there.
>> >> >> >> >> >>>> Best wishes,
>> >> >> >> >> >>>> Luc
>> >> >> >> >> >>>> On 16 Aug 2019, at 21:45, Aaron Brewster <
>> asbrewster(a)lbl.gov<mailto:[email protected]>> wrote:
>> >> >> >> >> >>>> Hi, to avoid clouding Dorothee's documentation email
>> thread, which I think is a highly useful enterprise, here's some thoughts
>> about putting cctbx into pip. Pip doesn't install non-python dependencies
>> well. I don't think boost is available as a package on pip (at least the
>> package version we use). wxPython4 isn't portable through pip (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__wiki.wxpython.org_How-… ).
>> MPI libraries are system dependent. If cctbx were a pure python package,
>> pip would be fine, but cctbx is not.
>> >> >> >> >> >>>> All that said, we could build a manylinux1 version of
>> cctbx and upload it to PyPi (I'm just learning about this). For a pip
>> package to be portable (which is a requirement for cctbx), it needs to
>> conform to PEP513, the manylinux1 standard (
>> https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep… ). For example, numpy is built
>> according to this standard (see https://urldefense.proofpoint.com/v2/url?u=https-3A__pypi.org_project_numpy… ,
>> where you'll see the manylinux1 wheel). Note, the manylinux1 standard is
>> built with Centos 5.11 which we no longer support.
>> >> >> >> >> >>>> There is also a manylinux2010 standard, which is based
>> on Centos 6 (https://urldefense.proofpoint.com/v2/url?u=https-3A__www.python.org_dev_pep… ). This is likely
>> a more attainable target (note though by default C++11 is not supported on
>> Centos 6).
>> >> >> >> >> >>>> If we built a manylinuxX version of cctbx and uploaded
>> it to PyPi, the user would need all the non-python dependencies. There's
>> no way to specify these in pip. For example, cctbx requires boost 1.63 or
>> better. The user will need to have it in a place their python can find it,
>> or we could package it ourselves and supply it, similar to how the pip h5py
>> package now comes with an hd5f library, or how the pip numpy package
>> includes an openblas library. We'd have to do the same for any packages we
>> depend on that aren't on pip using the manylinux standards, such as
>> wxPython4.
>> >> >> >> >> >>>> Further, we need to think about how dials and other
>> cctbx-based packages interact. If pip install cctbx is set up, how does
>> pip install dials work, such that any dials shared libraries can find the
>> cctbx libraries? Can shared libraries from one pip package link against
>> libraries in another pip package? Would each package need to supply its
>> own boost? Possibly this is well understood in the pip field, but not by
>> me :)
>> >> >> >> >> >>>> Finally, there's the option of providing a source pip
>> package. This would require the full compiler toolchain for any given
>> platform (macOS, linux, windows). These are likely available for
>> developers, but not for general users.
>> >> >> >> >> >>>> Anyway, these are some of the obstacles. Not saying it
>> isn't possible, it's just a lot of effort.
>> >> >> >> >> >>>> Thanks,
>> >> >> >> >> >>>> -Aaron
>> >> >> >> >> >>>> _______________________________________________
>> >> >> >> >> >>>> cctbxbb mailing list
>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >>>> _______________________________________________
>> >> >> >> >> >>>> cctbxbb mailing list
>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >>>> _______________________________________________
>> >> >> >> >> >>>> cctbxbb mailing list
>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org<mailto:
>> cctbxbb(a)phenix-online.org>
>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >>>> --
>> >> >> >> >> >>>> This e-mail and any attachments may contain
>> confidential, copyright and or privileged material, and are for the use of
>> the intended addressee only. If you are not the intended addressee or an
>> authorised recipient of the addressee please notify us of receipt by
>> returning the e-mail and do not use, copy, retain, distribute or disclose
>> the information in or attached to the e-mail.
>> >> >> >> >> >>>> Any opinions expressed within this e-mail are those of
>> the individual and not necessarily of Diamond Light Source Ltd.
>> >> >> >> >> >>>> Diamond Light Source Ltd. cannot guarantee that this
>> e-mail or any attachments are free from viruses and we cannot accept
>> liability for any damage which you may sustain as a result of software
>> viruses which may be transmitted in or with the message.
>> >> >> >> >> >>>> Diamond Light Source Limited (company no. 4375679).
>> Registered in England and Wales with its registered office at Diamond
>> House, Harwell Science and Innovation Campus, Didcot, Oxfordshire, OX11
>> 0DE, United Kingdom
>> >> >> >> >> >>>> _______________________________________________
>> >> >> >> >> >>>> cctbxbb mailing list
>> >> >> >> >> >>>> cctbxbb(a)phenix-online.org
>> >> >> >> >> >>>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >>> _______________________________________________
>> >> >> >> >> >>> cctbxbb mailing list
>> >> >> >> >> >>> cctbxbb(a)phenix-online.org
>> >> >> >> >> >>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >>
>> >> >> >> >> >>
>> >> >> >> >> >> _______________________________________________
>> >> >> >> >> >> cctbxbb mailing list
>> >> >> >> >> >> cctbxbb(a)phenix-online.org
>> >> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >> >
>> >> >> >> >> >
>> >> >> >> >> > _______________________________________________
>> >> >> >> >> > cctbxbb mailing list
>> >> >> >> >> > cctbxbb(a)phenix-online.org
>> >> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >>
>> >> >> >> >>
>> >> >> >> >> _______________________________________________
>> >> >> >> >> cctbxbb mailing list
>> >> >> >> >> cctbxbb(a)phenix-online.org
>> >> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >> >
>> >> >> >> > _______________________________________________
>> >> >> >> > cctbxbb mailing list
>> >> >> >> > cctbxbb(a)phenix-online.org
>> >> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >>
>> >> >> >>
>> >> >> >>
>> >> >> >> --
>> >> >> >> Gergely Katona, PhD
>> >> >> >> Associate Professor
>> >> >> >> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> >> >> >> Box 462, 40530 G?teborg, Sweden
>> >> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> >> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> >> >> >>
>> >> >> >> _______________________________________________
>> >> >> >> cctbxbb mailing list
>> >> >> >> cctbxbb(a)phenix-online.org
>> >> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >> >
>> >> >> > _______________________________________________
>> >> >> > cctbxbb mailing list
>> >> >> > cctbxbb(a)phenix-online.org
>> >> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >>
>> >> >>
>> >> >>
>> >> >> --
>> >> >> Gergely Katona, PhD
>> >> >> Associate Professor
>> >> >> Department of Chemistry and Molecular Biology, University of
>> Gothenburg
>> >> >> Box 462, 40530 G?teborg, Sweden
>> >> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> >> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> >> >>
>> >> >> _______________________________________________
>> >> >> cctbxbb mailing list
>> >> >> cctbxbb(a)phenix-online.org
>> >> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >> >
>> >> > _______________________________________________
>> >> > cctbxbb mailing list
>> >> > cctbxbb(a)phenix-online.org
>> >> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >>
>> >>
>> >>
>> >> --
>> >> Gergely Katona, PhD
>> >> Associate Professor
>> >> Department of Chemistry and Molecular Biology, University of Gothenburg
>> >> Box 462, 40530 G?teborg, Sweden
>> >> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> >> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>> >>
>> >> _______________________________________________
>> >> cctbxbb mailing list
>> >> cctbxbb(a)phenix-online.org
>> >> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>> >
>> > _______________________________________________
>> > cctbxbb mailing list
>> > cctbxbb(a)phenix-online.org
>> > https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>>
>>
>>
>> --
>> Gergely Katona, PhD
>> Associate Professor
>> Department of Chemistry and Molecular Biology, University of Gothenburg
>> Box 462, 40530 G?teborg, Sweden
>> Tel: +46-31-786-3959 / M: +46-70-912-3309 / Fax: +46-31-786-3910
>> Web: https://urldefense.proofpoint.com/v2/url?u=http-3A__katonalab.eu&d=DwICAg&c… , Email: gergely.katona(a)gu.se
>>
>> _______________________________________________
>> cctbxbb mailing list
>> cctbxbb(a)phenix-online.org
>> https://urldefense.proofpoint.com/v2/url?u=http-3A__phenix-2Donline.org_mai…
>>
>
1
0
Hi everyone,
To mitigate disruptions from future power shut offs due to wildfire
concerns, we are performing an emergency power test for our web servers.
This will affect the phenix-online.org and cci.lbl.gov servers. The
websites, mailing lists, and repositories will remain available, but the
servers will be running on emergency power instead.
The servers will be switched to emergency power at around 2 pm Pacific time
on Friday (12/13) and switched back to main power around 10 am Pacific time
on Monday (12/16). Please let me know if you experience any issues. Thanks!
--
Billy K. Poon
Research Scientist, Molecular Biophysics and Integrated Bioimaging
Lawrence Berkeley National Laboratory
1 Cyclotron Road, M/S 33R0345
Berkeley, CA 94720
Tel: (510) 486-5709
Fax: (510) 486-5909
Web: https://phenix-online.org
3
4