August 2010 - phenixbb - phenix-online.org

Restraint creation for ligand
by Hermella Woldemdihin 10 Aug '10

10 Aug '10

Hi! I was trying to fit my ligands into my model and density. And I have successfully fitted 2 ligands (same molecule) but my 3rd ligand is different molecule. After fitting my 3rd ligand (with COOT) and merged it with my protein, II created a restraint file with: phenix.elbow my_model_coot-0..pdb --do-all --output=all_ligands It created all_ligand.cif, which I used for in my next refinement with Phenix (GUI). I supplied my density, model and the restraint file and run phenix.refine. Unfortunatate I'm getting this error message when it starts to run phenix.refine and opening COOT window: Sorry: Fatal problems interpreting PDB file: Number of atoms with unknown nonbonded energy type symbols: 1 Please edit the PDB file to resolve the problems and/or supply a CIF file with matching restraint definitions, along with apply_cif_modification and apply_cif_link parameter definitions if necessary (see phenix.refine documentation). Also note that phenix.elbow is available to create restraint definitions for unknown ligands. I have use the same procedure for fitting my first 2 ligands. and it worked. But this time it failed! What do you think I should do? Thanks Hermi

3 2

monomer-dimer
by intekhab alam 10 Aug '10

10 Aug '10

Hi everyone Sorry for some non specific query!!!!! i am working with a protein that shows a dimer in the crystal structure but when i tried to figure out that with standard molecular markers in gel filteration (superdex-200, 24ml column) it turned out to be a monnomer. Native gel analysis after incubating the protein at 20 degree, 37 degree showed more dimer at 20 degree celcius as compared to 37. I tried similar strategy in gel filteration by incubating my protein at various temperature,where a lot of precipitation was observed at 37 degree celcius and after removing the precipitates i run the gel filteration that has 0.5 ml higher elution volume as compared to samples incubated at 20 degree celcius and 4 degree celcius.( Is this significant) Furthermore i have done some experiments in cold room (4 degree) where the elution volume is stuck at a point irrespective of the conditions (as Flow rate, concentration of protein etc) and that is higher than that of the room temperature by 1 ml. Standard moleculr weight markers also show higher elution volume in cold room in comparison to the room temperature by 1 ml. I will be highly obliged if someone suggest some literature or any otherway to do gel filtrtaion so that i can clearly resolve this issue. Also let me know if there is some literature available on effect of temperature on the elution volume of proteins. Thanks in advance -- INTEKHAB ALAM LABORATORY OF STRUCTURAL BIOINFORMATICS KOREA UNIVERSITY, SEOUL

2 2

Phenix reflection statistics
by Lepore, Bryan 07 Aug '10

07 Aug '10

in this table : Overall correlation: 0.901 unused: - 16.7088 [ 0/9 ] bin 1: 16.7088 - 2.0456 [5236/5928] 0.858 bin 2: 2.0456 - 1.6241 [5610/5946] 0.744 bin 3: 1.6241 - 1.4189 [5539/5925] 0.641 bin 4: 1.4189 - 1.2892 [5357/5873] 0.516 bin 5: 1.2892 - 1.1969 [5405/5972] 0.497 bin 6: 1.1969 - 1.1263 [5241/5939] 0.464 bin 7: 1.1263 - 1.0699 [5067/5903] 0.408 bin 8: 1.0699 - 1.0234 [4960/5934] 0.416 bin 9: 1.0234 - 0.9840 [4808/5941] 0.376 bin 10: 0.9840 - 0.9500 [4700/5931] 0.348 unused: 0.9500 - [3339/6874] 0.330 the average CC is 0.508 +/- 0.17 if y is the correlation, and x is bin number, and 0.330 is excluded, that line fits with a CC=-0.941 (therefore R^2=0.885) is the median resolution per bin used for the overall CC? how is "unused" treated? -bryan

2 1

syntax for Averaged Kicked maps and maps.param
by amadrona＠uci.edu 06 Aug '10

06 Aug '10

Hello, Disclaimer: I am a newbie to both crystallagraphy and Phenix. I am running phenix.refine (v1.6-289) in the command line 1. I want to make averaged "kicked-maps" but I keep getting a syntax error. I tried renaming "maps.param" but this file was not recognized. 2. When I enter Phenix.maps into the command line I get a message that syas "not implemented" I am trying to get the latest versiou of phenix installed. The following is the syntax I put in my custom_params file Thanks -Yarrow refinement.main.number_of_macro_cycles = 2 #refinement.main.fix_rotamers = True refinement.refine.strategy = individual_sites+individual_adp refinement.output.prefix = CIN4_refine_omit refinement.output.serial = 12 refinement.output.write_def_file = True refinement.target_weights_wxc.scale = 0.2 refinement.main.max_number_of_interations=15 refinement.electron_density_maps { map { mtz_label_amplitudes = "2FOFCWT_kick" mtz_label_phases = "PH2FOFCWT_kick" likelihood_weighted = True obs_factor = 2 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = True } map { mtz_label_amplitudes = "FOFCWT_kicked" mtz_label_phases = "PHFOFCWT_kicked" likelihood_weighted = True obs_factor = 1 calc_factor = 1 kicked = True fill_missing_f_obs_with_weighted_f_model = false }

3 3

high average b-factor vs. Wilson B
by Geoffrey Feld 06 Aug '10

06 Aug '10

Dear PhenixBBers, I'm working on a 1.45 A structure I solved using MR (phaser) and I'm pretty close to finishing, just plopping in waters and fixing rotamers. Rw = 19.8 Rfree= 22.8. I am a little concerned because my Wilson B is 27.00 while my average B for macromolecule is more like 43, and for solvent is 48. I have enough data to use anisotropic ADP refinement, which was a big help in bringing down the Rfree, but the average B hasn't really moved much. Should I be concerned about this? Should I try adjusting the wxu, or some other parameter? Thanks! -- Geoffrey K. Feld Department of Chemistry 492 Stanley Hall University of California, Berkeley "Vigilia pretium libertatis"

7 13

Phenix reflection statistics
by James Fraser 06 Aug '10

06 Aug '10

What does the correlation coefficient that is reported at the end of phenix.reflection_statistics represent? (I would assume the CC of F1 vs F2 for all reflections with an observation in datasets 1 and 2). The documentation "...the output will also show the correlations between the datasets and, if applicable, between the anomalous differences, both as overall values and in bins." is a bit ambiguous. Also in the below comparison, how would the overall correlation be 0.901 when all the bins have correlations between 0.330-0.858? CC Obs 2 3 0.901 h,k,l Correlation of: 2: 1.mtz:F-obs,SIGF-obs 3: 2.mtz:F-obs,SIGF-obs Overall correlation: 0.901 unused: - 16.7088 [ 0/9 ] bin 1: 16.7088 - 2.0456 [5236/5928] 0.858 bin 2: 2.0456 - 1.6241 [5610/5946] 0.744 bin 3: 1.6241 - 1.4189 [5539/5925] 0.641 bin 4: 1.4189 - 1.2892 [5357/5873] 0.516 bin 5: 1.2892 - 1.1969 [5405/5972] 0.497 bin 6: 1.1969 - 1.1263 [5241/5939] 0.464 bin 7: 1.1263 - 1.0699 [5067/5903] 0.408 bin 8: 1.0699 - 1.0234 [4960/5934] 0.416 bin 9: 1.0234 - 0.9840 [4808/5941] 0.376 bin 10: 0.9840 - 0.9500 [4700/5931] 0.348 unused: 0.9500 - [3339/6874] 0.330 Thanks, James -- James Fraser jaimefraser(a)gmail.com Alber Lab 356 Stanley Hall, QB3 UC Berkeley Berkeley, CA 94720 http://ucxray.berkeley.edu/~jfraser/

3 2

indicating proper SUBJECT
by Alexandre Urzhumtsev 06 Aug '10

06 Aug '10

Hello, Sorry to interfere, in no case I want to play a police. However, I would like to ask all phenixbb-participants to respect other and when sending their mails : - to USE the "subject" in all sending mesages (no mails with empty "subject") and - to use it PROPERLY (just recently we had several examples of irrelevant subject; I do not want to point them out explicitly) Indicating a proper subject is a matter of saving time of others, making proper archives and facilitating searches in them later. This problem is also relevant to the CCP4bb even when a similar request of putting proper "subject" was posted there many times. (Personally, I think this should be done in ANY correspondence, even to your friends, not only to phenixbb or ccp4bb.) In addition, I think that a presence of your name at the end of your mail is also a rule of a politeness (that is also not respected in a number of letters to our bb-s). With best regards, Sacha

2 1

unknown parameters file format?
by Kyle Dolan 06 Aug '10

06 Aug '10

Hi all, I tried to create my own set of refinement parameters by copying sections of a .def file to a new file I called myrefine1.params. When I tried to use this for phenix.refine from the command line I received this error message: Sorry: Unknown file format: myrefine1.params What should I do? Thanks, Kyle Kyle T. Dolan Department of Biochemistry and Molecular Biology The University of Chicago ktd(a)uchicago.edu

3 2

Re: [phenixbb] follow up on message 2: phenix.maps --Message: not implemented
by amadrona＠uci.edu 06 Aug '10

06 Aug '10

Hello Pavel, The averaged kicked map looks great! I am able to see loop density that I could not see before. However, I still have one question: The kicked map were created when I put the map parameters in my custom_par file however, I was unable to run Phenix.maps in the command line. When I do this I get a message "Not implemented". I would like to create a ccp4 map for viewing in pymol without running refinement again. Do you know what could be causing this message? If I create "maps.params" by inserting the commands from the .def file Phenix does not recognize this file format. Any help would be appreciated. Thank you. -Yarrow > Send phenixbb mailing list submissions to > phenixbb(a)phenix-online.org > > To subscribe or unsubscribe via the World Wide Web, visit > http://phenix-online.org/mailman/listinfo/phenixbb > or, via email, send a message with subject or body 'help' to > phenixbb-request(a)phenix-online.org > > You can reach the person managing the list at > phenixbb-owner(a)phenix-online.org > > When replying, please edit your Subject line so it is more specific > than "Re: Contents of phenixbb digest..." > > > Today's Topics: > > 1. syntax for Averaged Kicked maps and maps.param (amadrona(a)uci.edu) > 2. Re: syntax for Averaged Kicked maps and maps.param (Pavel Afonine) > 3. Re: Phenix Autobuild (Thomas C. Terwilliger) > 4. New version complaint (Simon Kolstoe) > 5. Re: New version complaint (Nathaniel Echols) > 6. Re: New version complaint (Douglas Jacobsen) > 7. Re: New version complaint (Nathaniel Echols) > 8. Adequate size for Free R test set? (Joseph Noel) > > > ---------------------------------------------------------------------- > > Message: 1 > Date: Mon, 2 Aug 2010 17:38:05 -0700 > From: amadrona(a)uci.edu > To: phenixbb(a)phenix-online.org > Subject: [phenixbb] syntax for Averaged Kicked maps and maps.param > Message-ID: > <c56fb1561f816b0462d50ccdeb996317.squirrel(a)webmail.uci.edu> > Content-Type: text/plain;charset=iso-8859-1 > > Hello, > > Disclaimer: I am a newbie to both crystallagraphy and Phenix. > > I am running phenix.refine (v1.6-289) in the command line > > 1. I want to make averaged "kicked-maps" but I keep getting a syntax > error. I tried renaming "maps.param" but this file was not recognized. > > 2. When I enter Phenix.maps into the command line I get a message that > syas "not implemented" > I am trying to get the latest versiou of phenix installed. > > The following is the syntax I put in my custom_params file > Thanks > > -Yarrow > > refinement.main.number_of_macro_cycles = 2 > #refinement.main.fix_rotamers = True > refinement.refine.strategy = individual_sites+individual_adp > refinement.output.prefix = CIN4_refine_omit > refinement.output.serial = 12 > refinement.output.write_def_file = True > refinement.target_weights_wxc.scale = 0.2 > refinement.main.max_number_of_interations=15 > > > refinement.electron_density_maps { > map { > mtz_label_amplitudes = "2FOFCWT_kick" > mtz_label_phases = "PH2FOFCWT_kick" > likelihood_weighted = True > obs_factor = 2 > calc_factor = 1 > kicked = True > fill_missing_f_obs_with_weighted_f_model = True > } > map { > mtz_label_amplitudes = "FOFCWT_kicked" > mtz_label_phases = "PHFOFCWT_kicked" > likelihood_weighted = True > obs_factor = 1 > calc_factor = 1 > kicked = True > fill_missing_f_obs_with_weighted_f_model = false > } > > > > ------------------------------ > > Message: 2 > Date: Mon, 02 Aug 2010 17:48:45 -0700 > From: Pavel Afonine <pafonine(a)lbl.gov> > To: PHENIX user mailing list <phenixbb(a)phenix-online.org> > Subject: Re: [phenixbb] syntax for Averaged Kicked maps and maps.param > Message-ID: <4C57676D.9000901(a)lbl.gov> > Content-Type: text/plain; charset=ISO-8859-1; format=flowed > > Hi Yarrow, > > you can use GUI or the command line for doing this. > > 0) It would be best if you update to the latest version, although I > believe it might work with the one you have too: > > http://www.phenix-online.org/download/ > > 1) GUI: launch PHENIX GUI and go to Maps -> Create Maps. then just add > as many maps you want (or use pre-defined ones) and check a box for kick > map. > > 2) From the command line type: > > phenix.maps > > and hit Enter (Return). That will create a file called something > maps.params. Edit that file to add/remove the maps you need/ don't need > and set > > kicked = True > > for the one you want to be "kicked", and then run > > phenix.maps maps.params > > Let me know if you have any questions or problems. > > Good luck! > Pavel. > > > On 8/2/10 5:38 PM, amadrona(a)uci.edu wrote: >> Hello, >> >> Disclaimer: I am a newbie to both crystallagraphy and Phenix. >> >> I am running phenix.refine (v1.6-289) in the command line >> >> 1. I want to make averaged "kicked-maps" but I keep getting a syntax >> error. I tried renaming "maps.param" but this file was not recognized. >> >> 2. When I enter Phenix.maps into the command line I get a message that >> syas "not implemented" >> I am trying to get the latest versiou of phenix installed. >> >> The following is the syntax I put in my custom_params file >> Thanks >> >> -Yarrow >> >> refinement.main.number_of_macro_cycles = 2 >> #refinement.main.fix_rotamers = True >> refinement.refine.strategy = individual_sites+individual_adp >> refinement.output.prefix = CIN4_refine_omit >> refinement.output.serial = 12 >> refinement.output.write_def_file = True >> refinement.target_weights_wxc.scale = 0.2 >> refinement.main.max_number_of_interations=15 >> >> >> refinement.electron_density_maps { >> map { >> mtz_label_amplitudes = "2FOFCWT_kick" >> mtz_label_phases = "PH2FOFCWT_kick" >> likelihood_weighted = True >> obs_factor = 2 >> calc_factor = 1 >> kicked = True >> fill_missing_f_obs_with_weighted_f_model = True >> } >> map { >> mtz_label_amplitudes = "FOFCWT_kicked" >> mtz_label_phases = "PHFOFCWT_kicked" >> likelihood_weighted = True >> obs_factor = 1 >> calc_factor = 1 >> kicked = True >> fill_missing_f_obs_with_weighted_f_model = false >> } >> >> _______________________________________________ >> phenixbb mailing list >> phenixbb(a)phenix-online.org >> http://phenix-online.org/mailman/listinfo/phenixbb > > > > ------------------------------ > > Message: 3 > Date: Tue, 3 Aug 2010 07:26:46 -0600 (MDT) > From: "Thomas C. Terwilliger" <terwilliger(a)lanl.gov> > To: "Md. Munan Shaik" <munanbt2004(a)YAHOO.COM> > Cc: phenixbb(a)phenix-online.org > Subject: Re: [phenixbb] Phenix Autobuild > Message-ID: <24375.128.165.0.81.1280842006.squirrel(a)webmail.lanl.gov> > Content-Type: text/plain;charset=iso-8859-1 > > Hi Munan Shaik, > > Phenix autobuild can read several types of sequence files, but the basic > format is very simple: enter one copy of the sequence of each chain, > separated by a blank line or a line starting with ">" between chains. > You can optionally add any lines starting with ">" which will be ignored. > So here is an example: > >>>> alpha subunit (type 1) > MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAENPSTALHKVSELYDRL > GFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANAYAQTLGTIFTEQPKPYEV > EICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTTEPIATAMRESYRADLDLEAA > VGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRRAFRRIAGTALEQLVPAEPAAAS > ESAPEPKPDTETKPADTQD >>>> beta subunit (type 1) > MTADRPALRTGDRDTRLSFGSNLSSFTDYLRGHAPELLPENRIGHRSHSTRGGDGMESGD > LAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDEYSAAGIAGTAGIAIEL > VRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAMQGLAVVPLLVGYDLDADDES > RAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKIYSPDSDEETALRAAIESLYDAA > DDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARRIVAERTEQGGSAR > > Please let me know if that doesn't do it! > > All the best, > Tom T > > > > > > >>> Hi everybody, >>> I have a problem with Phenix autobuild. I want to input sequence file >>> together >>> with the pdb and mtz that I got from molecular replacement. But I have >>> no >>> idea >>> which types of sequence files its required. if anybody please help me >>> out. >>> >>> >>> thanks >>> =================================================== >>> Md. Munan Shaik >>> Department of Chemical Biology >>> University of Padova >>> via G. Colombo 03 >>> Padova 35131, Italy >>> >>> >>> > > > > ------------------------------ > > Message: 4 > Date: Tue, 3 Aug 2010 15:31:46 +0100 > From: Simon Kolstoe <s.kolstoe(a)ucl.ac.uk> > To: PHENIX user mailing list <phenixbb(a)phenix-online.org> > Subject: [phenixbb] New version complaint > Message-ID: <8976EDFE-4E7E-42FD-96FE-319B56DE5413(a)ucl.ac.uk> > Content-Type: text/plain; charset=US-ASCII; format=flowed; delsp=yes > > Hi there, > > I've been using version 1.6.2-432 on a Macbook and was particularly > enjoying the "Show Histograms" button on the POLYGON results page. > However today I updated to version 1.6.4-486 using the dmg installer, > and that useful option has disappeared! Is there a good reason for the > absence of this function, and if not can we get it back? > > Thanks, > > Simon > > --------------------------------------------------------------- > Dr Simon Kolstoe > Laboratory for Protein Crystallography > Centre for Amyloidosis & Acute Phase Proteins > UCL Medical School > Rowland Hill Street, London NW3 2PF > > Tel: 020 7433 2765 > http://www.ucl.ac.uk/~rmhasek > -------------------------------------------------------------- > > > > ------------------------------ > > Message: 5 > Date: Tue, 3 Aug 2010 07:39:11 -0700 > From: Nathaniel Echols <nechols(a)lbl.gov> > To: PHENIX user mailing list <phenixbb(a)phenix-online.org> > Subject: Re: [phenixbb] New version complaint > Message-ID: > <AANLkTikU_SS2Z2VU0aZuqRNgrYUiiXLCTfztYy7NZjOF(a)mail.gmail.com> > Content-Type: text/plain; charset="iso-8859-1" > > On Tue, Aug 3, 2010 at 7:31 AM, Simon Kolstoe <s.kolstoe(a)ucl.ac.uk> wrote: > >> I've been using version 1.6.2-432 on a Macbook and was particularly >> enjoying the "Show Histograms" button on the POLYGON results page. >> However >> today I updated to version 1.6.4-486 using the dmg installer, and that >> useful option has disappeared! Is there a good reason for the absence of >> this function, and if not can we get it back? >> > > There is a reason, but not a good one. I'll fix it later today. FYI, the > "PDB Statistics" tool offers another way to view histograms, although it > requires that you manually specify the resolution range. > > -Nat >

6 14

B-factors
by Hermella Woldemdihin 05 Aug '10

05 Aug '10

Hi All! Where can I set B-factor for water in phenix.refine on the GUI version of phenix? Thanks!

3 2